Recombinant Mouse IL-2R a/IL-2RA/CD25 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKHHHHHH |
Source: Human Cells.
MW :25.5kD.
Recombinant Mouse Interleukin-2 receptor subunit alpha is produced by our Mammalian expression system and the target gene encoding Glu22-Lys236 is expressed with a 6His tag at the C-terminus. The interleukin 2 receptor alpha (IL2RA), also called CD25, is a type I transmembrane protein that presents on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. IL2RA is a member of cytokine receptors family that utilizes the common gamma chain subunit (gc). IL2RA is expressed in most B-cell neoplasms, some acute nonlymphocytic leukemias, neuroblastomas, and tumor infiltrating lymphocytes. IL2RA associates with IL2RB (CD122) to form a heterodimer that can act as a high-affinity receptor for IL-2.
MW :25.5kD.
Recombinant Mouse Interleukin-2 receptor subunit alpha is produced by our Mammalian expression system and the target gene encoding Glu22-Lys236 is expressed with a 6His tag at the C-terminus. The interleukin 2 receptor alpha (IL2RA), also called CD25, is a type I transmembrane protein that presents on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. IL2RA is a member of cytokine receptors family that utilizes the common gamma chain subunit (gc). IL2RA is expressed in most B-cell neoplasms, some acute nonlymphocytic leukemias, neuroblastomas, and tumor infiltrating lymphocytes. IL2RA associates with IL2RB (CD122) to form a heterodimer that can act as a high-affinity receptor for IL-2.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
|
There are currently no product reviews
|












.png)







