Recombinant Mouse Inducible T-cell Costimulator/ICOS(C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLHHHHHH |
Source: Human cells.
MW :14.7kD.
Recombinant Mouse Inducible T-cell Costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Leu142 is expressed with a 6His tag at the C-terminus. Inducible Costimulator(ICOS) is a member of the growing CD28 family of immune costimulatory receptors. Other family members are CD28, CTLA4 and PD1. ICOS shares approximately 39% amino acid similarity with CD 28 and CTLA4. Mouse and human ICOS share approximately 72% amino acid identity. ICOS is expressed on most CD45RO+ cells. ICOS expression is up-regulated within approximately 24-48 hours of activation on Th primed cells. B7-H2, a member of the B7 family of costimulatory ligands, has been identified as the ICOS ligand. The B7-H2/ ICOS interaction appears to play roles in T cell dependent B cell activation and Th differentiation. In addition, ICOS is more potent in the induction of IL-10 production, acytokine important for suppressive function of T regulatory cells.
MW :14.7kD.
Recombinant Mouse Inducible T-cell Costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Leu142 is expressed with a 6His tag at the C-terminus. Inducible Costimulator(ICOS) is a member of the growing CD28 family of immune costimulatory receptors. Other family members are CD28, CTLA4 and PD1. ICOS shares approximately 39% amino acid similarity with CD 28 and CTLA4. Mouse and human ICOS share approximately 72% amino acid identity. ICOS is expressed on most CD45RO+ cells. ICOS expression is up-regulated within approximately 24-48 hours of activation on Th primed cells. B7-H2, a member of the B7 family of costimulatory ligands, has been identified as the ICOS ligand. The B7-H2/ ICOS interaction appears to play roles in T cell dependent B cell activation and Th differentiation. In addition, ICOS is more potent in the induction of IL-10 production, acytokine important for suppressive function of T regulatory cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Expressed on activated T-cells and resting memory T-cells. High expression seen in the thymic medulla and in the germinal centers and T-cell zones of lymph nodes and Peyer patches. Expressed at low levels in the spleen. |
|
There are currently no product reviews
|












.png)







