Recombinant Mouse Interleukin-2 Receptor Subunit Gamma/IL-2 R gamma/CIDX (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :55.1kD.
Recombinant Mouse Interleukin-2 Receptor Subunit Gamma is produced by our Mammalian expression system and the target gene encoding Ser25-Ala263 is expressed with a Fc tag at the C-terminus. The Interleukin-2 receptor gamma chain (IL-2 R gamma , CD132) of the high affinity functional mouse IL-2 receptor complex is a member the hematopoietin receptor family. It is expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. Common IL2 receptor- gamma Chain is required for IL-2 receptor signaling. Besides IL-2, the Common IL2 receptor- gamma chain has been shown to be a component of the functional receptor complexes for IL-4, IL-7, IL-9 and IL-15. It is a component of multiple cytokine receptors that are essential for lymphocyte development and function. Common IL2 receptor- gamma Chain is also designated the common gamma chain.
MW :55.1kD.
Recombinant Mouse Interleukin-2 Receptor Subunit Gamma is produced by our Mammalian expression system and the target gene encoding Ser25-Ala263 is expressed with a Fc tag at the C-terminus. The Interleukin-2 receptor gamma chain (IL-2 R gamma , CD132) of the high affinity functional mouse IL-2 receptor complex is a member the hematopoietin receptor family. It is expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. Common IL2 receptor- gamma Chain is required for IL-2 receptor signaling. Besides IL-2, the Common IL2 receptor- gamma chain has been shown to be a component of the functional receptor complexes for IL-4, IL-7, IL-9 and IL-15. It is a component of multiple cytokine receptors that are essential for lymphocyte development and function. Common IL2 receptor- gamma Chain is also designated the common gamma chain.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|





















.png)







