Recombinant Mouse Interleukin-21/IL-21
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Source: E.coli.
MW :14.4kD.
Recombinant Mouse Interleukin-21 is produced by our E.coli expression system and the target gene encoding Pro25-Ser146 is expressed. Interleukin-21 also known as IL-21 is a protein that in mouse is encoded by the IL21 gene, belongs to the IL-15/IL-21 family. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
MW :14.4kD.
Recombinant Mouse Interleukin-21 is produced by our E.coli expression system and the target gene encoding Pro25-Ser146 is expressed. Interleukin-21 also known as IL-21 is a protein that in mouse is encoded by the IL21 gene, belongs to the IL-15/IL-21 family. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
There are currently no product reviews
|