Recombinant Mouse Interleukin-5 Receptor Subunit Alpha/IL-5 Ra (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHHHHHHH |
Source: Human Cells.
MW :37.6kD.
Recombinant Mouse Interleukin-5 Receptor Subunit Alpha is produced by our Mammalian expression system and the target gene encoding Asp18-His339 is expressed with a 6His tag at the C-terminus. Interleukin 5 Receptor alpha (IL-5 Ra), also known as CD125, is a hematopoietin receptor that plays a dominant role in eosinophil biology. Mature mouse IL-5 Ra consists of a 322 amino acid (aa) extracellular domain (ECD) with a WSxWS motif and a four cysteine motif, a 22 aa transmembrane segment, and a 54 aa cytoplasmic domain. The high affinity receptor for IL-5 is a complex that consists of the ligand binding IL-5 Ra and the transmembrane common beta chain ( betac/CD131) which is shared with the receptor complexes for IL-3 and GM-CSF. IL-5 Ra binds IL-5 at low affinity and then associates with preformed betac oligomers to form the signaling-competent receptor complex. IL-5 stimulation of CD34+ hematopoietic progenitor cells induces the up-regulation of transmembrane IL-5 Ra followed by eosinophilic differentiation and activation. IL-5 Ra also promotes the differentiation of basophils and B cells. Exposure of mature eosinophils to IL-5 attenuates their IL-5 responsiveness by inducing the down-regulation of surface IL-5 Ra and increased production of soluble IL-5 Ra.
MW :37.6kD.
Recombinant Mouse Interleukin-5 Receptor Subunit Alpha is produced by our Mammalian expression system and the target gene encoding Asp18-His339 is expressed with a 6His tag at the C-terminus. Interleukin 5 Receptor alpha (IL-5 Ra), also known as CD125, is a hematopoietin receptor that plays a dominant role in eosinophil biology. Mature mouse IL-5 Ra consists of a 322 amino acid (aa) extracellular domain (ECD) with a WSxWS motif and a four cysteine motif, a 22 aa transmembrane segment, and a 54 aa cytoplasmic domain. The high affinity receptor for IL-5 is a complex that consists of the ligand binding IL-5 Ra and the transmembrane common beta chain ( betac/CD131) which is shared with the receptor complexes for IL-3 and GM-CSF. IL-5 Ra binds IL-5 at low affinity and then associates with preformed betac oligomers to form the signaling-competent receptor complex. IL-5 stimulation of CD34+ hematopoietic progenitor cells induces the up-regulation of transmembrane IL-5 Ra followed by eosinophilic differentiation and activation. IL-5 Ra also promotes the differentiation of basophils and B cells. Exposure of mature eosinophils to IL-5 attenuates their IL-5 responsiveness by inducing the down-regulation of surface IL-5 Ra and increased production of soluble IL-5 Ra.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Expressed on eosinophils and basophils. Also on B-cells. |
|
There are currently no product reviews
|








.png)









