Recombinant Mouse Lithostathine-2/Reg2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHQVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA |
Source: Human Cells.
MW :17.7kD.
Recombinant Mouse Islets of Langerhans regenerating protein 2 is produced by our Mammalian expression system and the target gene encoding Gln23-Ala173 is expressed with a 6His tag at the N-terminus. Regenerating protein 2 (Reg2) also known as Lithostathine 2, pancreatic thread protein (PTP2) and pancreatic stone protein 2 (PSP2), is a member of the Reg family of proteins. These small, secreted proteins have been implicated in a range of physiological processes including acting as acute phase reactants, lectins, survival/growth factors for insulin-producing pancreatic beta-cells, neural cells, and epithelial cells of the digestive system. Studies also indicate a role for Reg family members in tumor formation and indicate their potential for use as biomarkers of carcinogenesis. Mouse Reg2 is expressed in regenerating islets and normal exocrine pancreas. Reg2 also stimulates the growth of pancreatic beta cells. Mouse Reg2 belongs to the type II subclass of the Reg family and is the only subclass II Reg protein described.
MW :17.7kD.
Recombinant Mouse Islets of Langerhans regenerating protein 2 is produced by our Mammalian expression system and the target gene encoding Gln23-Ala173 is expressed with a 6His tag at the N-terminus. Regenerating protein 2 (Reg2) also known as Lithostathine 2, pancreatic thread protein (PTP2) and pancreatic stone protein 2 (PSP2), is a member of the Reg family of proteins. These small, secreted proteins have been implicated in a range of physiological processes including acting as acute phase reactants, lectins, survival/growth factors for insulin-producing pancreatic beta-cells, neural cells, and epithelial cells of the digestive system. Studies also indicate a role for Reg family members in tumor formation and indicate their potential for use as biomarkers of carcinogenesis. Mouse Reg2 is expressed in regenerating islets and normal exocrine pancreas. Reg2 also stimulates the growth of pancreatic beta cells. Mouse Reg2 belongs to the type II subclass of the Reg family and is the only subclass II Reg protein described.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, weakly in liver, but not at all in gall bladder. |
|
There are currently no product reviews
|












.png)






