Recombinant Mouse Phospholipase A2 Group IB/PLA2G1B (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM HEPES,150mM NaCl,pH 7.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFCHHHHHH |
Source: Human Cells.
MW :15.6kD.
Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is expressed with a 6His tag at the C-terminus. Mouse phospholipase A2 is a secreted protein which belongs to the phospholipase A2 family. Phospholipase A2/PLA2G1B catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. PLA2G1B has been thought to play major role in digestion of glycerophospholipids in nutrients, given its abundance in digestive organs. Since its expression has been observed in non-digestive organs including the lung, spleen, kidney, ovary, retina, brain, and neurons, its function may not limited to digestive role. PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.
MW :15.6kD.
Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is expressed with a 6His tag at the C-terminus. Mouse phospholipase A2 is a secreted protein which belongs to the phospholipase A2 family. Phospholipase A2/PLA2G1B catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. PLA2G1B has been thought to play major role in digestion of glycerophospholipids in nutrients, given its abundance in digestive organs. Since its expression has been observed in non-digestive organs including the lung, spleen, kidney, ovary, retina, brain, and neurons, its function may not limited to digestive role. PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically (By similarity). |
|
There are currently no product reviews
|















.png)








