Recombinant Mouse Renin (C-10His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARGGGGSHHHHHHHHHH |
Source: Human Cells.
MW :43.5kD.
Recombinant Mouse Renin is produced by our Mammalian expression system and the target gene encoding Leu22-Arg402 is expressed with a 10His tag at the C-terminus. Mouse Renin, also known as Renin-1,is a member of the peptidase A1 amily. Renin is synthesized by the juxtaglomerular cells of the kidney in response to decreased blood pressure and sodium concentration. It cleaves angiotensinogen to generate angiotensin I, which can be further converted by angiotensin converting enzyme (ACE) to angiotensin II. Angiotensin II is the active molecule of the reninangiotensin system that acts by binding to angiotensin receptors type 1 and 2 (AT1 and AT2),and has direct pathophysiological effects on the heart and peripheral vasculature. After secretion, inactive prorenin can be proteolytically activated by trypsin, cathepsin B, or other proteinases.
MW :43.5kD.
Recombinant Mouse Renin is produced by our Mammalian expression system and the target gene encoding Leu22-Arg402 is expressed with a 10His tag at the C-terminus. Mouse Renin, also known as Renin-1,is a member of the peptidase A1 amily. Renin is synthesized by the juxtaglomerular cells of the kidney in response to decreased blood pressure and sodium concentration. It cleaves angiotensinogen to generate angiotensin I, which can be further converted by angiotensin converting enzyme (ACE) to angiotensin II. Angiotensin II is the active molecule of the reninangiotensin system that acts by binding to angiotensin receptors type 1 and 2 (AT1 and AT2),and has direct pathophysiological effects on the heart and peripheral vasculature. After secretion, inactive prorenin can be proteolytically activated by trypsin, cathepsin B, or other proteinases.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Membrane |
| Tissue Specificity: | Kidney. |
|
There are currently no product reviews
|














.png)










