Recombinant Mouse Resistin/ADSF/RETN (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVASVDHHHHHH |
Source: Human Cells.
MW :11.2kD.
Recombinant Mouse Adipose tissue-specific secretory factor is produced by our Mammalian expression system and the target gene encoding Ser21-Ser114 is expressed with a 6His tag at the C-terminus. Resistin is a cysteine-rich adipose-derived peptide hormone, which belongs to the resistin/FIZZ family. Resistin has been shown to cause high levels of 'bad' cholesterol (low-density lipoprotein or LDL), increasing the risk of heart disease, resistin increases the production of LDL in human liver cells and also degrades LDL receptors in the liver. As a result, the liver is less able to clear 'bad' cholesterol from the body. Resistin accelerates the accumulation of LDL in arteries, increasing the risk of heart disease, resistin adversely impacts the effects of statins, the main cholesterol-reducing drug used in the treatment and prevention of cardiovascular disease.
MW :11.2kD.
Recombinant Mouse Adipose tissue-specific secretory factor is produced by our Mammalian expression system and the target gene encoding Ser21-Ser114 is expressed with a 6His tag at the C-terminus. Resistin is a cysteine-rich adipose-derived peptide hormone, which belongs to the resistin/FIZZ family. Resistin has been shown to cause high levels of 'bad' cholesterol (low-density lipoprotein or LDL), increasing the risk of heart disease, resistin increases the production of LDL in human liver cells and also degrades LDL receptors in the liver. As a result, the liver is less able to clear 'bad' cholesterol from the body. Resistin accelerates the accumulation of LDL in arteries, increasing the risk of heart disease, resistin adversely impacts the effects of statins, the main cholesterol-reducing drug used in the treatment and prevention of cardiovascular disease.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed in white but not brown adipose tissue in a variety of organs. |
|
There are currently no product reviews
|















.png)











