Recombinant Mouse Sonic Hedgehog/SHH
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Source: E.coli.
MW :19.8kD.
Recombinant Mouse Sonic Hedgehog is produced by our E.coli expression system and the target gene encoding Cys25-Gly198 is expressed. Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH). Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa NÂterminal fragment (ShhÂN), and a catalyticÂprocessing,glycosylated, 34 kDa, 239 aa CÂterminal fragment. The 20 kDa ShhÂN fragment is the core of the active hedgehog molecule. Mouse ShhÂN is 99%, 98%, and 100% aa identical to human, rat and gerbil ShhÂN, respectively.
MW :19.8kD.
Recombinant Mouse Sonic Hedgehog is produced by our E.coli expression system and the target gene encoding Cys25-Gly198 is expressed. Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH). Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa NÂterminal fragment (ShhÂN), and a catalyticÂprocessing,glycosylated, 34 kDa, 239 aa CÂterminal fragment. The 20 kDa ShhÂN fragment is the core of the active hedgehog molecule. Mouse ShhÂN is 99%, 98%, and 100% aa identical to human, rat and gerbil ShhÂN, respectively.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Sonic hedgehog protein N-product: The lipidated N- and C-terminal peptides of ShhNp can be cleaved (shedding)(PubMed:24522195). The N-terminal palmitoylated peptide is cleaved at the Cardin-Weintraub (CW) motif site (PubMed:24522195). The cleavage reduced the interactions with heparan sulfate (PubMed:23118222). The cleavage is enhanced by SCUBE2. |
| Tissue Specificity: | Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina. |
| BioGrid: | 203220. 10 interactions. |
|
There are currently no product reviews
|










.png)











