Recombinant Mouse Syndecan-Binding Protein 1/Syntenin-1/SDCBP (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEVLEHHHHHH |
Source: E.coli.
MW :33.4kD.
Recombinant Mouse Syntenin-1 is produced by our E.coli expression system and the target gene encoding Ser2-Val299 is expressed with a 6His tag at the C-terminus. SDCBP, also called syntenin-1, is short for Syndecan-binding protein 1. It is expressed by the gene Sdcbp. SDCBP seems to function as an adapter protein. In adherens junctions, the protein may function to couple syndecans to cytoskeletal proteins or signaling components. Meanwhile it seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). SDCBP also play a role in vesicular trafficking, and is required for the targeting of TGFA to the cell surface in the early secretory pathway.
MW :33.4kD.
Recombinant Mouse Syntenin-1 is produced by our E.coli expression system and the target gene encoding Ser2-Val299 is expressed with a 6His tag at the C-terminus. SDCBP, also called syntenin-1, is short for Syndecan-binding protein 1. It is expressed by the gene Sdcbp. SDCBP seems to function as an adapter protein. In adherens junctions, the protein may function to couple syndecans to cytoskeletal proteins or signaling components. Meanwhile it seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). SDCBP also play a role in vesicular trafficking, and is required for the targeting of TGFA to the cell surface in the early secretory pathway.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell junction, Cell junction, Cell membrane, Endoplasmic reticulum membrane, Nucleus, Melanosome, Cytoplasm, Cytoplasm, Secreted, Membrane raft |
| Post transnational modification: | Phosphorylated on tyrosine residues. |
| BioGrid: | 207300. 2 interactions. |
|
There are currently no product reviews
|













.png)









