Recombinant Mouse Transforming Growth Factor beta-1/TGF beta1/TGFB1
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 50mM Glycine,150mM NaCl,pH 2.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Source: Human Cells.
MW :12.8kD.
Recombinant Mouse Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming growth factor beta 1 (TGF beta1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF- beta1, TGF- beta2 and TGF- beta3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
MW :12.8kD.
Recombinant Mouse Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming growth factor beta 1 (TGF beta1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF- beta1, TGF- beta2 and TGF- beta3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive. |
| BioGrid: | 204157. 4 interactions. |
|
There are currently no product reviews
|

















.png)








