Recombinant Mouse Tumor Necrosis Factor/TNFa
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Source: E. coli.
MW :16.4kD.
Recombinant Mouse Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Asp89-Leu235 is expressed. Tumor Necrosis Factor (TNF) is a member of the Tumor Necrosis Factor family. TNF exists as a homotrimer and interacts with SPPL2B. TNF is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. TNF is a key cytokine in the development of several inflammatory disorders. It contributes to the development of type 2 diabetes throught its effects on insulin resistance and fatty acid metabolism.
MW :16.4kD.
Recombinant Mouse Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Asp89-Leu235 is expressed. Tumor Necrosis Factor (TNF) is a member of the Tumor Necrosis Factor family. TNF exists as a homotrimer and interacts with SPPL2B. TNF is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. TNF is a key cytokine in the development of several inflammatory disorders. It contributes to the development of type 2 diabetes throught its effects on insulin resistance and fatty acid metabolism.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid. |
| BioGrid: | 204240. 12 interactions. |
|
There are currently no product reviews
|











.png)








