Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Primary Cells
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

Share:

Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

Roll over image to zoom in

   

Product code: 32-190008

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   20 µg

  •  100 µg

  • $515.00 

  • $781.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Review   (0)
Amount : 100 µg
Purification : Greater than 90% as determined by SDS-PAGE.
Content : Tris-based buffer50% glycerol
Storage condition : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
AA sequence : Expression Region:638-767aa ; N-terminal 6xHis-SUMO-tagged; SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Uniprot ID : P14740
Alternative Name : Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name: DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen: CD26 Cleaved into the following 3 chains: Dipeptidyl peptidase 4 membrane form Alternative name(s): Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name(s): Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name(s): Dipeptidyl peptidase IV 60KDA soluble form

Source : E.coli ; Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor,CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the Extracellular domain matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-TNF-alpha (Tumor Necrosis Factor alpha) Monoclonal Antibody(Clone: 4C6-H8)

Anti-TNF-alpha (Tumor Necrosis...

details-Anti-TNF-alpha (Tumor Necrosis Factor alpha) Monoclonal Antibody(Clone: 4C6-H8)
SARS-CoV-2 Nucleocapsid Antibody (Clone: 1G5)

SARS-CoV-2 Nucleocapsid Antibo...

details-SARS-CoV-2 Nucleocapsid Antibody (Clone: 1G5)
Biotinylated Recombinant Rabbit Monoclonal Antibody  to Human IgG2 (Clone: RM118)(Discontinued)

Biotinylated Recombinant Rabbi...

details-Biotinylated Recombinant Rabbit Monoclonal Antibody  to Human IgG2 (Clone: RM118)(Discontinued)
Recombinant HepatitisA Virus VP1

Recombinant HepatitisA Virus V...

details-Recombinant HepatitisA Virus VP1
Anti-von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) Monoclonal Antibody(Clone: VWF/1465)

Anti-von Willebrand Factor / F...

details-Anti-von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) Monoclonal Antibody(Clone: VWF/1465)
Anti-CD20 / MS4A1 (B-Cell Marker) Polyclonal Antibody

Anti-CD20 / MS4A1 (B-Cell Mark...

details-Anti-CD20 / MS4A1 (B-Cell Marker) Polyclonal Antibody
Anti-CD40, Mouse Monoclonal Antibody(Clone: FGK45.5)

Anti-CD40, Mouse Monoclonal An...

details-Anti-CD40, Mouse Monoclonal Antibody(Clone: FGK45.5)
G alpha 15 Stable Cell Line-DP1-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-DP...

details-G alpha 15 Stable Cell Line-DP1-CHO-K1-Human(Currently Unavailable)
Anti-IL-4 (Interleukin-4), Mouse Monoclonal Antibody(Clone: 11B11)

Anti-IL-4 (Interleukin-4), Mou...

details-Anti-IL-4 (Interleukin-4), Mouse Monoclonal Antibody(Clone: 11B11)
Anti-CD72 (B Cell Marker) Monoclonal Antibody(Clone: BU40)

Anti-CD72 (B Cell Marker) Mono...

details-Anti-CD72 (B Cell Marker) Monoclonal Antibody(Clone: BU40)
Anti-E-Cadherin / CD324 (Intercellular Junction Marker) Monoclonal Antibody(Clone: SPM471)

Anti-E-Cadherin / CD324 (Inter...

details-Anti-E-Cadherin / CD324 (Intercellular Junction Marker) Monoclonal Antibody(Clone: SPM471)
Anti-CD71 / Transferrin Receptor (TFRC) (Extracellular Domain) Monoclonal Antibody(Clone: TFRC/1839)

Anti-CD71 / Transferrin Recept...

details-Anti-CD71 / Transferrin Receptor (TFRC) (Extracellular Domain) Monoclonal Antibody(Clone: TFRC/1839)
Anti-CD47 / IAP (Integrin Associated Protein) Monoclonal Antibody(Clone: CD47/3019)

Anti-CD47 / IAP (Integrin Asso...

details-Anti-CD47 / IAP (Integrin Associated Protein) Monoclonal Antibody(Clone: CD47/3019)
Anti-ZAP70 (Chronic Lymphocytic Leukemia Marker) Monoclonal Antibody(Clone: ZAP70/2047)

Anti-ZAP70 (Chronic Lymphocyti...

details-Anti-ZAP70 (Chronic Lymphocytic Leukemia Marker) Monoclonal Antibody(Clone: ZAP70/2047)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Peroxidase conjugated Goat anti Mouse IgG (H+L)

Peroxidase conjugated Goat anti Mou...

details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

Related Products

BCL2L2, His Recombinant Protein

BCL2L2, His Recombinant Protein

Recombinant Mouse Chordin-Like Protein 2/CHL2/CHRDL2 (C-6His)

Recombinant Mouse Chordin-Like Protein 2/CHL2/CHRDL2 (C-6His)

Batroxobin Recombinant Protein (Discontinued)

Batroxobin Recombinant Protein (Discontinued)

New Products

Phospho-4E-BP1 (Thr37/46) (Clone: A5) rabbit mAb APC conjugate

Phospho-4E-BP1 (Thr37/46) (Clone: A5) rabbit mAb APC conjugate

Phospho-Btk (Tyr551) (Clone: G12) rabbit mAb Biotin conjugate

Phospho-Btk (Tyr551) (Clone: G12) rabbit mAb Biotin conjugate

Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (Clone: A11) rabbit mAb

Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (Clone: A11) rabbit mAb

close

Please Login to write a Review !!


close

Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

Product code: 32-190008
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2021 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart