Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

    Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

    Share:

    Figure 1: Coomassie stain analysis of Recombinant Rat Dipeptidyl peptidase 4(Dpp4)

    Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

    Roll over image to zoom in

       

    Product code: 32-190008

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price

    Available Pack Size(s)

    •   20 µg

    •  100 µg

    • $515.00 

    • $838.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Review   (0)
    Amount : 100 µg
    Purification : Greater than 90% as determined by SDS-PAGE.
    Content : Tris-based buffer50% glycerol
    Storage condition : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
    AA sequence : Expression Region:638-767aa ; N-terminal 6xHis-SUMO-tagged; SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
    Uniprot ID : P14740
    Alternative Name : Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name: DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen: CD26 Cleaved into the following 3 chains: Dipeptidyl peptidase 4 membrane form Alternative name(s): Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name(s): Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name(s): Dipeptidyl peptidase IV 60KDA soluble form

    Source : E.coli ; Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor,CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the Extracellular domain matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Monoclonal Antibody to human PECAM-1

    Monoclonal Antibody to human P...

    details-Monoclonal Antibody to human PECAM-1
    Anti-RPSA Antibody (Clone : RP-01)

    Anti-RPSA Antibody (Clone : RP...

    details-Anti-RPSA Antibody (Clone : RP-01)
    Monoclonal antibody to CD16 (Clone: B73.1)

    Monoclonal antibody to CD16 (C...

    details-Monoclonal antibody to CD16 (Clone: B73.1)
    Anti-Human CD279 (PD-1) (Nivolumab) – PE

    Anti-Human CD279 (PD-1) (Nivol...

    details-Anti-Human CD279 (PD-1) (Nivolumab) – PE
    Sars-Cov-2 Spike Glycoprotein S1 (Derived from SF9 cell line)

    Sars-Cov-2 Spike Glycoprotein ...

    details-Sars-Cov-2 Spike Glycoprotein S1 (Derived from SF9 cell line)
    Anti-Human IL-2R alpha (CD25) (Basiliximab) – Fc Muted™

    Anti-Human IL-2R alpha (CD25) ...

    details-Anti-Human IL-2R alpha (CD25) (Basiliximab) – Fc Muted™
    Anti-TIGIT Antibody ((vibostolimab biosimilar) (MK-7684)

    Anti-TIGIT Antibody ((vibostol...

    details-Anti-TIGIT Antibody ((vibostolimab biosimilar) (MK-7684)
    Anti-CD34 Monoclonal Antibody (Clone:IHC034)

    Anti-CD34 Monoclonal Antibody ...

    details-Anti-CD34 Monoclonal Antibody (Clone:IHC034)
    Monoclonal Antibody to Mouse CD20 NALE™ Purified (Clone: AISB12)

    Monoclonal Antibody to Mouse C...

    details-Monoclonal Antibody to Mouse CD20 NALE™ Purified (Clone: AISB12)
    Rat IgG2b Isotype Control FITC Antibody (Clone : S193)

    Rat IgG2b Isotype Control FITC...

    details-Rat IgG2b Isotype Control FITC Antibody (Clone : S193)
    Rat Anti-Mouse CD22-LENA™ (Low Endotoxin No Azide)

    Rat Anti-Mouse CD22-LENA™ (Lo...

    details-Rat Anti-Mouse CD22-LENA™ (Low Endotoxin No Azide)
    Camostat (mesylate)

    Camostat (mesylate)

    details-Camostat (mesylate)
    MMP 3 HEK Recombinant Protein

    MMP 3 HEK Recombinant Protein

    details-MMP 3 HEK Recombinant Protein
    Anti-E-cadherin Monoclonal Antibody (Clone:IHC564)-Ready to Use

    Anti-E-cadherin Monoclonal Ant...

    details-Anti-E-cadherin Monoclonal Antibody (Clone:IHC564)-Ready to Use

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    CENPB Recombinant Protein

    CENPB Recombinant Protein

    mGRO g His Recombinant Protein

    mGRO g His Recombinant Protein

    IFNB 1a Recombinant Protein

    IFNB 1a Recombinant Protein

    close

    Please Login to write a Review !!


    close

    Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial

    Product code: 32-190008
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart