Recombinant Rat IgG2A Fc/Igg-2a(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris, pH 8.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Gene : | Igg-2a |
| Uniprot ID : | P20760 |
Source: Human Cells.
MW :35.2kD.
Recombinant Rat Immunoglobulin G2A Fc is produced by our Mammalian expression system and the target gene encoding Val98-Lys322 is expressed. Immunoglobulin G (IgG) is a type of antibody composed of four peptide chains—two identical heavy chains and two identical light chains arranged in a Y-shape typical of antibody monomers.There are four IgG subclasses (IgG1, 2, 3, and 4) in humans, named in order of their abundance in serum. The IgG2a isotype was able to interact very efficiently with FcgammaR, and share approximately 64-78% amino acid sequence identity with IgG1 and IgG2b in the heavy chain constant region domains, CH1, CH2 and CH3, which cause the diffrence in the interaction with complement, NK and mast cells, induction or inhibition by specific cytokines, and ability to cross the placenta.
MW :35.2kD.
Recombinant Rat Immunoglobulin G2A Fc is produced by our Mammalian expression system and the target gene encoding Val98-Lys322 is expressed. Immunoglobulin G (IgG) is a type of antibody composed of four peptide chains—two identical heavy chains and two identical light chains arranged in a Y-shape typical of antibody monomers.There are four IgG subclasses (IgG1, 2, 3, and 4) in humans, named in order of their abundance in serum. The IgG2a isotype was able to interact very efficiently with FcgammaR, and share approximately 64-78% amino acid sequence identity with IgG1 and IgG2b in the heavy chain constant region domains, CH1, CH2 and CH3, which cause the diffrence in the interaction with complement, NK and mast cells, induction or inhibition by specific cytokines, and ability to cross the placenta.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|














.png)









