Recombinant Rat Tropic 1808
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Purification : | Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Content : | The Tropic-1808 was lyophilized from 1X PBS, pH 7.4. |
| Storage condition : | Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles. |
| AA sequence : | MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS. |
| Alternative Name : | Tropic 1808, Tpc1808. |
Source : Escherichia Coli.
Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa.The Tpc1808 is purified by proprietary chromatographic techniques.
Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|














.png)










