Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Streptavidin

Recombinant Streptavidin

Share:

Recombinant Streptavidin

Roll over image to zoom in

   

Product code: 32-4989

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
20 mg
$388.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 20 mg
Purification : Greater than 98.0% as determined by SDS-PAGE and HPLC.
Content : Lyophilized in 10mM potassium phosphate buffer pH 6.5.
Storage condition : Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
AA sequence : MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

Source : Escherichia Coli. Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa. Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.

It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-ERBB2 (trastuzumab biosimilar) mAb

Anti-ERBB2 (trastuzumab biosim...

details-Anti-ERBB2 (trastuzumab biosimilar) mAb
Phospho-Jak3 (Tyr980/981) (Clone: E10) rabbit mAb

Phospho-Jak3 (Tyr980/981) (Clo...

details-Phospho-Jak3 (Tyr980/981) (Clone: E10) rabbit mAb
Anti-GRAP2 APC (Clone : UW40)

Anti-GRAP2 APC (Clone : UW40)

details-Anti-GRAP2 APC (Clone : UW40)
Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1832)

Anti-Spectrin Alpha 1 (Erythro...

details-Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1832)
Mouse Anti-Human ZAP-70-PE

Mouse Anti-Human ZAP-70-PE

details-Mouse Anti-Human ZAP-70-PE
Anti-Human VEGF (Bevacizumab) – HRP

Anti-Human VEGF (Bevacizumab) ...

details-Anti-Human VEGF (Bevacizumab) – HRP
Anti-Human OX40L (Oxelumab) – Fc Muted™

Anti-Human OX40L (Oxelumab) –...

details-Anti-Human OX40L (Oxelumab) – Fc Muted™
GLRX2 Recombinant Protein

GLRX2 Recombinant Protein

details-GLRX2 Recombinant Protein
Anti-MICA/MICB PE (Clone : 6D4)

Anti-MICA/MICB PE (Clone : 6D4...

details-Anti-MICA/MICB PE (Clone : 6D4)
Mouse Monoclonal Antibody to Phosphotyrosine (Clone : 18E10D2)(Discontinued)

Mouse Monoclonal Antibody to P...

details-Mouse Monoclonal Antibody to Phosphotyrosine (Clone : 18E10D2)(Discontinued)
Anti-Human CD318 FITC (Clone : CUB1)

Anti-Human CD318 FITC (Clone :...

details-Anti-Human CD318 FITC (Clone : CUB1)
C1QTNF3 Recombinant Protein

C1QTNF3 Recombinant Protein

details-C1QTNF3 Recombinant Protein
Anti-MICA/MICB FITC (Clone : 6D4)

Anti-MICA/MICB FITC (Clone : 6...

details-Anti-MICA/MICB FITC (Clone : 6D4)
SARS-CoV-2 (2019-nCoV) Spike S1 South African Mutant (K417N / E484K / N501Y) His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S...

details-SARS-CoV-2 (2019-nCoV) Spike S1 South African Mutant (K417N / E484K / N501Y) His Tag Protein

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

DCAF7 Recombinant Protein

DCAF7 Recombinant Protein

Recombinant Human RWD Domain Containing 1

Recombinant Human RWD Domain Containing 1

k9Clusterin HEK Recombinant Protein

k9Clusterin HEK Recombinant Protein

New Products

Anti-M-CSF(lacnotuzumab biosimilar) mAb

Anti-M-CSF(lacnotuzumab biosimilar) mAb

Recombinant Human VPS52

Recombinant Human VPS52

Anti-CD10 antibody(DM176), Rabbit mAb

Anti-CD10 antibody(DM176), Rabbit mAb

close

Please Login to write a Review !!


close

Recombinant Streptavidin

Product code: 32-4989
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart