Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Streptavidin

    Recombinant Streptavidin

    Share:

    Recombinant Streptavidin

    Roll over image to zoom in

       

    Product code: 32-4989

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    20 mg
    $349.00  $296.65 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 20 mg
    Purification : Greater than 98.0% as determined by SDS-PAGE and HPLC.
    Content : Lyophilized in 10mM potassium phosphate buffer pH 6.5.
    Storage condition : Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
    AA sequence : MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

    Source : Escherichia Coli. Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa. Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.

    It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    GPC3 Stable Cell Line-H

    GPC3 Stable Cell Line-H

    details-GPC3 Stable Cell Line-H
    Polyclonal Antibody to IFNA-314

    Polyclonal Antibody to IFNA-31...

    details-Polyclonal Antibody to IFNA-314
    Phospho-Jak3 (Tyr980/981) (Clone: E10) rabbit mAb

    Phospho-Jak3 (Tyr980/981) (Clo...

    details-Phospho-Jak3 (Tyr980/981) (Clone: E10) rabbit mAb
    Recombinant human PTGER4 protein with C-terminal human Fc tag

    Recombinant human PTGER4 prote...

    details-Recombinant human PTGER4 protein with C-terminal human Fc tag
    Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH/ARH1 (N-6His)

    Recombinant Human ADP-Ribosyla...

    details-Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH/ARH1 (N-6His)
    Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1832)

    Anti-Spectrin Alpha 1 (Erythro...

    details-Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1832)
    Recombinant Human Pro-Neuregulin-1/NRG1b1/HRG1b1 (Ser177-Glu241)

    Recombinant Human Pro-Neuregul...

    details-Recombinant Human Pro-Neuregulin-1/NRG1b1/HRG1b1 (Ser177-Glu241)
    Mouse Monoclonal Antibody to Human PRTN3 (Clone : 15E12D7)(Discontinued)

    Mouse Monoclonal Antibody to H...

    details-Mouse Monoclonal Antibody to Human PRTN3 (Clone : 15E12D7)(Discontinued)
    Monoclonal Antibody to Human/Mouse TLR2 (Clone : mT2.7)

    Monoclonal Antibody to Human/M...

    details-Monoclonal Antibody to Human/Mouse TLR2 (Clone : mT2.7)
    Anti-Hairy Cell Leukemia Monoclonal Antibody (Clone:IHC687)

    Anti-Hairy Cell Leukemia Monoc...

    details-Anti-Hairy Cell Leukemia Monoclonal Antibody (Clone:IHC687)
    Recombinant Human Fc gamma RIIB/CD32b (C-His)

    Recombinant Human Fc gamma RII...

    details-Recombinant Human Fc gamma RIIB/CD32b (C-His)
    Recombinant SARS-CoV-2 Spike Protein (RBD) (C-His, insect cells)

    Recombinant SARS-CoV-2 Spike P...

    details-Recombinant SARS-CoV-2 Spike Protein (RBD) (C-His, insect cells)
    Flt3 Ligand HEK Recombinant Protein

    Flt3 Ligand HEK Recombinant Pr...

    details-Flt3 Ligand HEK Recombinant Protein
    Recombinant Cynomolgus CD3d /CD3 delta Protein (C-Fc)

    Recombinant Cynomolgus CD3d /C...

    details-Recombinant Cynomolgus CD3d /CD3 delta Protein (C-Fc)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Human Eptifibatide

    Human Eptifibatide

    Recombinant Mouse Cathepsin B/CTSB (C-6His)

    Recombinant Mouse Cathepsin B/CTSB (C-6His)

    Platelet factor-4 Native Protein

    Platelet factor-4 Native Protein

    New Products

    Recombinant Anti-Monkeypox A33 Antibody (Clone: MPXV-56)

    Recombinant Anti-Monkeypox A33 Antibody (Clone: MPXV-56)

    Anti-Andes Virus (Hantavirus) (Clone: ANDV-44)

    Anti-Andes Virus (Hantavirus) (Clone: ANDV-44)

    Anti-Japanese Encephalitis Virus (Clone: JEV-75)

    Anti-Japanese Encephalitis Virus (Clone: JEV-75)

    close

    Please Login to write a Review !!


    close

    Recombinant Streptavidin

    Product code: 32-4989
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart