Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Streptavidin

Recombinant Streptavidin

Share:

Recombinant Streptavidin

Roll over image to zoom in

   

Product code: 32-4989

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
20 mg
$388.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 20 mg
Purification : Greater than 98.0% as determined by SDS-PAGE and HPLC.
Content : Lyophilized in 10mM potassium phosphate buffer pH 6.5.
Storage condition : Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
AA sequence : MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

Source : Escherichia Coli. Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa. Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.

It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Desmoglein-2 (DSG2) Monoclonal Antibody(Clone: 8E5)

Anti-Desmoglein-2 (DSG2) Monoc...

details-Anti-Desmoglein-2 (DSG2) Monoclonal Antibody(Clone: 8E5)
Anti-GRAP2 APC (Clone : UW40)

Anti-GRAP2 APC (Clone : UW40)

details-Anti-GRAP2 APC (Clone : UW40)
HCV LFA(Discontinued)

HCV LFA(Discontinued)

details-HCV LFA(Discontinued)
Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1832)

Anti-Spectrin Alpha 1 (Erythro...

details-Anti-Spectrin Alpha 1 (Erythrocyte Marker) Monoclonal Antibody(Clone: SPTA1/1832)
Anti-HSP60 Monoclonal Antibody (Clone : LK1) Alkaline Phosphatase

Anti-HSP60 Monoclonal Antibody...

details-Anti-HSP60 Monoclonal Antibody (Clone : LK1) Alkaline Phosphatase
Anti-Human CD268 Antibody (Clone : 11C1)

Anti-Human CD268 Antibody (Clo...

details-Anti-Human CD268 Antibody (Clone : 11C1)
Anti-SARS CoV2 Spike RBD Antibody (Clone: ABM6G1.1A2)

Anti-SARS CoV2 Spike RBD Antib...

details-Anti-SARS CoV2 Spike RBD Antibody (Clone: ABM6G1.1A2)
Anti-Human CD172a PE (Clone : 15-414)

Anti-Human CD172a PE (Clone : ...

details-Anti-Human CD172a PE (Clone : 15-414)
Anti-HSP60 Monoclonal Antibody (Clone : LK1) ATTO 594

Anti-HSP60 Monoclonal Antibody...

details-Anti-HSP60 Monoclonal Antibody (Clone : LK1) ATTO 594
Recombinant SARS-CoV-2 S1+S2 ECD (S-ECD) Protein His tag

Recombinant SARS-CoV-2 S1+S2 E...

details-Recombinant SARS-CoV-2 S1+S2 ECD (S-ECD) Protein His tag
Recombinant human ENPP3 protein with C-terminal human Fc tag

Recombinant human ENPP3 protei...

details-Recombinant human ENPP3 protein with C-terminal human Fc tag
Anti-PD-1 Antibody (pembrolizumab biosimilar) (MK-3475)

Anti-PD-1 Antibody (pembrolizu...

details-Anti-PD-1 Antibody (pembrolizumab biosimilar) (MK-3475)
Anti-CD22 antibody(DM13), Rabbit mAb

Anti-CD22 antibody(DM13), Rabb...

details-Anti-CD22 antibody(DM13), Rabbit mAb
Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) APC(Discontinued)

Anti-HSP90 beta Monoclonal Ant...

details-Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) APC(Discontinued)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

Recombinant Human GPR15L(Discontinued)

Recombinant Human GPR15L(Discontinued)

Recombinant Human TNFAIP3 Interacting Protein 1

Recombinant Human TNFAIP3 Interacting Protein 1

OSM HEK Recombinant Protein(Discontinued)

OSM HEK Recombinant Protein(Discontinued)

New Products

Anti-Human CD316 MAb (Clone :8A12)

Anti-Human CD316 MAb (Clone :8A12)

Anti-Human CD158z MAb(Clone :CH21)

Anti-Human CD158z MAb(Clone :CH21)

Anti-Human CD369 APC  MAb(Clone :15E2)

Anti-Human CD369 APC MAb(Clone :15E2)

close

Please Login to write a Review !!


close

Recombinant Streptavidin

Product code: 32-4989
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart