Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. rMMP 9 Recombinant Protein

rMMP 9 Recombinant Protein

Share:

rMMP 9 Recombinant Protein

Roll over image to zoom in

   

Product code: 32-2557

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
10 µg
$363.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Review   (0)
Amount : 10 µg
Purification : Greater than 85.0% as determined by SDS-PAGE.
Content : The MMP-9 solution (0.3mg/ml) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Storage condition : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
AA sequence : APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYSACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSSCTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVPERLMYPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWPATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNKLHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVDSRSGAPVDQMFPGVPLNTHDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPEDENLYFQGLEEQKLISEEDLNSAVDHHHHHH.
Alternative Name : Matrix metalloproteinase-9, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
Source : Baculovirus system, insect cells.
MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707). The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.
Matrix metalloproteinases are a family of zinc and calcium-dependent endopeptidases that break down extracellular matrix proteins. The MMP9 is secreted as a 92kDa zymogen. Cleavage of ProMMP-9 results in the active enzyme, having a molecular weight of approximately 82kDa. MMP9 is composed of the following domains: a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by the several cell types: monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells. MMP9 is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 may also play an important part in local proteolysis of the extracellular matrix and in leukocyte migration, as well as in bone osteoclastic resorption. 
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Mouse Monoclonal Antibody to Human DDX41 (Clone : 4F3E11)(Discontinued)

Mouse Monoclonal Antibody to H...

details-Mouse Monoclonal Antibody to Human DDX41 (Clone : 4F3E11)(Discontinued)
Recombinant human CD32 protein with C-terminal human Fc tag

Recombinant human CD32 protein...

details-Recombinant human CD32 protein with C-terminal human Fc tag
Anti-Human CD279 (PD-1) (Nivolumab) – Fc Muted™

Anti-Human CD279 (PD-1) (Nivol...

details-Anti-Human CD279 (PD-1) (Nivolumab) – Fc Muted™
Urease Recombinant Protein

Urease Recombinant Protein

details-Urease Recombinant Protein
Recombinant Human Serpin Peptidase Inhibitor, Clade I Member 1, His Tag

Recombinant Human Serpin Pepti...

details-Recombinant Human Serpin Peptidase Inhibitor, Clade I Member 1, His Tag
Recombinant Human Serpin Peptidase Inhibitor, Clade A Member 8

Recombinant Human Serpin Pepti...

details-Recombinant Human Serpin Peptidase Inhibitor, Clade A Member 8
Anti-MSH2 Monoclonal Antibody (Clone:IHC410)

Anti-MSH2 Monoclonal Antibody ...

details-Anti-MSH2 Monoclonal Antibody (Clone:IHC410)
Anti-HSP60 Monoclonal Antibody (Clone : LK2) APC

Anti-HSP60 Monoclonal Antibody...

details-Anti-HSP60 Monoclonal Antibody (Clone : LK2) APC
Recombinant human ADAM17 protein with C-terminal human Fc tag

Recombinant human ADAM17 prote...

details-Recombinant human ADAM17 protein with C-terminal human Fc tag
Anti-CD71 / Transferrin Receptor Monoclonal Antibody (Clone:MEM-75)

Anti-CD71 / Transferrin Recept...

details-Anti-CD71 / Transferrin Receptor Monoclonal Antibody (Clone:MEM-75)
Anti-Transferrin Monoclonal Antibody (Clone:HTF-14)

Anti-Transferrin Monoclonal An...

details-Anti-Transferrin Monoclonal Antibody (Clone:HTF-14)
rTFF3 Recombinant Protein

rTFF3 Recombinant Protein

details-rTFF3 Recombinant Protein
Human Orosomucoid 1

Human Orosomucoid 1

details-Human Orosomucoid 1
Anti-CD40L Polyclonal Antibody

Anti-CD40L Polyclonal Antibody

details-Anti-CD40L Polyclonal Antibody

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

Recombinant Mouse Lipopolysaccarid Binding Protein

Recombinant Mouse Lipopolysaccarid Binding Protein

C19ORF80 Recombinant Protein

C19ORF80 Recombinant Protein

Recombinant Mouse PDGF R a/PDGFRA/CD140a (C-Fc)

Recombinant Mouse PDGF R a/PDGFRA/CD140a (C-Fc)

New Products

Anti-Human CD158z PE MAb(Clone :CH21)

Anti-Human CD158z PE MAb(Clone :CH21)

Anti-Human CD369 APC  MAb(Clone :15E2)

Anti-Human CD369 APC MAb(Clone :15E2)

Anti-Human CD85g APC MAb(Clone :17G10.2)

Anti-Human CD85g APC MAb(Clone :17G10.2)

close

Please Login to write a Review !!


close

rMMP 9 Recombinant Protein

Product code: 32-2557
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart