Eotaxin 2 Recombinant Protein
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 20 µg |
| Purification : | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Content : | The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. |
| Storage condition : | Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| AA sequence : | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA. |
| Alternative Name : | C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24. |
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|









.png)








