Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Cell Lines
  4. /
  5. Stable Cell Lines
  6. /
  7. GFP/HEK293 Stable Cell Line

GFP/HEK293 Stable Cell Line

Share:

Fig-1: Analysis of the GFP/HEK293 stable cell line through fluorescence microscopy. Bright-field image (Left); Fluorescence image (Right).

GFP/HEK293 Stable Cell Line
GFP/HEK293 Stable Cell Line

Roll over image to zoom in

   
Fig-1:  Analysis of the GFP/HEK293 stable cell line through fluorescence microscopy. Bright-field image (Left); Fluorescence image (Right).
Fig-2: Detection of GFP in the GFP/HEK293 stable cell line through flow cytometry . Parental HEK293 cells (Green); GFP/HEK293 cells (Red).

Product code: 14-900ACL

Application : Functional Assay, FACS

Shipping Info:

Order now and get it on Tuesday September 26, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Local delivery areas

Same-day delivery in San Diego available for the following zip codes:

92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
Download TDS / Manual MSDS
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
1 vial
$2,750.00  $2,200.00 

Add to Wish List

Bulk Order

Shipping Info:

Order now and get it on Tuesday September 26, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Download TDS / Manual MSDS

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 1 vial
Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Storage condition : Immediately upon receipt, store in liquid nitrogen.

GFP/HEK293 Stable Cell Line is  a stably transfected HEK293 cell line which expresses enhanced green fluorescent protein (eGFP).

Sequence data: Amino acid sequence of eGFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC
TTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQE
RTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNY
NSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGP
VLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

 

Application:.

  •  Screen for GFP through Flow Cytometry. 
  •  Screen for GFP through Fluorescence Microscopy.

Culture conditions:

Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 3 µg/ml of Puromycin.
 
It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Puromycin, spin down cells, resuspend cells in pre-warmed growth medium without Puromycin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
 
Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Puromycin. Cells should be split before they reach complete confluence.
 
To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
 
 
 

LIMITED USE RESTRICTIONS:

THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

By use of this product, user agrees to be bound by the terms of this limited use statement.

This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

 

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Integrin beta 4 Polyclonal Antibody

Anti-Integrin beta 4 Polyclona...

details-Anti-Integrin beta 4 Polyclonal Antibody
Recombinant human CD24 protein with C-terminal human Fc tag

Recombinant human CD24 protein...

details-Recombinant human CD24 protein with C-terminal human Fc tag
Monoclonal Antibody to HMGB1 (Clone: ABM2E44)

Monoclonal Antibody to HMGB1 (...

details-Monoclonal Antibody to HMGB1 (Clone: ABM2E44)
Recombinant 2019-nCoV S Protein RBD-SD1 (C-6His)

Recombinant 2019-nCoV S Protei...

details-Recombinant 2019-nCoV S Protein RBD-SD1 (C-6His)
Anti-IL6 Antibody (siltuximab biosimilar) (CLLB8)

Anti-IL6 Antibody (siltuximab ...

details-Anti-IL6 Antibody (siltuximab biosimilar) (CLLB8)
Anti-Monkeypox B5R Antibody (Clone: ABM2F3.3E5)

Anti-Monkeypox B5R Antibody (C...

details-Anti-Monkeypox B5R Antibody (Clone: ABM2F3.3E5)
STAT6 Leeporter™ Luciferase Reporter-Ba/F3 Cell Line

STAT6 Leeporter™ Luciferase ...

details-STAT6 Leeporter™ Luciferase Reporter-Ba/F3 Cell Line
Monoclonal Antibody to Mouse CD16/32 (Clone: 2.4G2)

Monoclonal Antibody to Mouse C...

details-Monoclonal Antibody to Mouse CD16/32 (Clone: 2.4G2)
Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : SPM496)

Monoclonal Antibody to CD45 / ...

details-Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : SPM496)
Anti-Human CD194 (CCR4) (Mogamulizumab)

Anti-Human CD194 (CCR4) (Mogam...

details-Anti-Human CD194 (CCR4) (Mogamulizumab)
Anti-Cytokeratin 18 Monoclonal Antibody (Clone:DC-10)

Anti-Cytokeratin 18 Monoclonal...

details-Anti-Cytokeratin 18 Monoclonal Antibody (Clone:DC-10)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

VEGFR2 Stable Cell Line-H

VEGFR2 Stable Cell Line-H

NKp30 Stable Cell Line

NKp30 Stable Cell Line

ICOS Stable Cell Line

ICOS Stable Cell Line

New Products

Anti-Hu CD156c PE Mab(11G2)

Anti-Hu CD156c PE Mab(11G2)

Human APP Protein, His Tag

Human APP Protein, His Tag

Anti-CD325 APC Mab(8C11)

Anti-CD325 APC Mab(8C11)

close

Please Login to write a Review !!


close

GFP/HEK293 Stable Cell Line

Product code: 14-900ACL
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart