Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • Cell Lines
        • Primary Cells
        • Reporter Cell Lines
        • Stable Cell Lines
      • Kits and Reagents
        • Inhibitor Screening Kit
        • Molecular Biology Kits
        • ELISA Kits
        • Apoptosis Detection kits
        • Luciferase reporter assay kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Immune-Check Point
      • Tissue Microarray
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Cell Lines
  4. /
  5. Stable Cell Lines
  6. /
  7. GPC3 Stable Cell Line

GPC3 Stable Cell Line

Share:

Fig-1: Detection of human GPC3 in the CHO-K1/GPC3 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/GPC3 cells (Red).

GPC3 Stable Cell Line

Roll over image to zoom in

   

Product code: 14-518ACL

Application : Functional Assay

Shipping Info:

Order now and get it on Tuesday January 19, 2021

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Local delivery areas

Same-day delivery in San Diego available for the following zip codes:

92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
Download TDS / Manual MSDS
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
1 Vial
$2,750.00 

Add to Wish List

Bulk Order

Shipping Info:

Order now and get it on Tuesday January 19, 2021

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Download TDS / Manual MSDS

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 1 Vial
Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Storage condition : Immediately upon receipt, store in liquid nitrogen.

GPC3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Glypican 3 (GPC3, also known as GTR2-2, OCI-5 and MXR7).

Sequence data: hGPC3 (accession number NP_004475)

MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQR
LQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKF
LIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSD
INVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQ
VSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGG
YCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYV
QKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELI
QKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHEL
KMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGG
SGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLT
SMAISVVCFFFLVH
 

Application:.

  •  Screen for antibodies of human GPC3 through Flow Cytometry. 

Culture conditions:

Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
 
It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
 
Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.
 
To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
 
 
 

LIMITED USE RESTRICTIONS:

THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

By use of this product, user agrees to be bound by the terms of this limited use statement.

This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

 

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

P2Y6 Stable Cell Line-1321N1-Human(Currently Unavailable)

P2Y6 Stable Cell Line-1321N1-H...

details-P2Y6 Stable Cell Line-1321N1-Human(Currently Unavailable)
Anti-HER-2 / c-erbB-2 / neu / CD340 Monoclonal Antibody(Clone: ERBB2/3257)

Anti-HER-2 / c-erbB-2 / neu / ...

details-Anti-HER-2 / c-erbB-2 / neu / CD340 Monoclonal Antibody(Clone: ERBB2/3257)
CCKB Stable Cell Line-CHO-K1-Human(Currently Unavailable)

CCKB Stable Cell Line-CHO-K1-H...

details-CCKB Stable Cell Line-CHO-K1-Human(Currently Unavailable)
Anti-CD4 (T-Helper/Inducer Cell Marker) Monoclonal Antibody(Clone: RIV7)

Anti-CD4 (T-Helper/Inducer Cel...

details-Anti-CD4 (T-Helper/Inducer Cell Marker) Monoclonal Antibody(Clone: RIV7)
Anti-C1QA / Complement C1q A-Chain Monoclonal Antibody(Clone: C1QA/2955)

Anti-C1QA / Complement C1q A-C...

details-Anti-C1QA / Complement C1q A-Chain Monoclonal Antibody(Clone: C1QA/2955)
G alpha 15 Stable Cell Line-NPS1a-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-NP...

details-G alpha 15 Stable Cell Line-NPS1a-CHO-K1-Human(Currently Unavailable)
Recombinant Aeromonas Aminopeptidase(Discontinued)

Recombinant Aeromonas Aminopep...

details-Recombinant Aeromonas Aminopeptidase(Discontinued)
Anti-Eosinophil Peroxidase (EPX) Monoclonal Antibody(Clone: AHE-1)

Anti-Eosinophil Peroxidase (EP...

details-Anti-Eosinophil Peroxidase (EPX) Monoclonal Antibody(Clone: AHE-1)
Anti-Calpain 1 Monoclonal Antibody(Clone: CAPN1/1530)

Anti-Calpain 1 Monoclonal Anti...

details-Anti-Calpain 1 Monoclonal Antibody(Clone: CAPN1/1530)
Anti-Sarcomeric Actinin Alpha 2 / ACTN2 Monoclonal Antibody(Clone: ACTN2/3295)

Anti-Sarcomeric Actinin Alpha ...

details-Anti-Sarcomeric Actinin Alpha 2 / ACTN2 Monoclonal Antibody(Clone: ACTN2/3295)
Recombinant HepatitisA Virus P2C

Recombinant HepatitisA Virus P...

details-Recombinant HepatitisA Virus P2C
G alpha 15 Stable Cell Line-CysLT1-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-Cy...

details-G alpha 15 Stable Cell Line-CysLT1-CHO-K1-Human(Currently Unavailable)
MCH1 Stable Cell Line-293-Human(Currently Unavailable)

MCH1 Stable Cell Line-293-Huma...

details-MCH1 Stable Cell Line-293-Human(Currently Unavailable)
Anti-Cyclin E (G1/S-Phase Cyclin) Monoclonal Antibody(Clone: CCNE1/2460)

Anti-Cyclin E (G1/S-Phase Cycl...

details-Anti-Cyclin E (G1/S-Phase Cyclin) Monoclonal Antibody(Clone: CCNE1/2460)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Peroxidase conjugated Goat anti Mouse IgG (H+L)

Peroxidase conjugated Goat anti Mou...

details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

Related Products

MCH1 Stable Cell Line-293-Human(Currently Unavailable)

MCH1 Stable Cell Line-293-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-OPRM1-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-OPRM1-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-NPS1b-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-NPS1b-CHO-K1-Human(Currently Unavailable)

New Products

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

close

Please Login to write a Review !!


close

GPC3 Stable Cell Line

Product code: 14-518ACL
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • recmAb™
  • Cell Lines
  • Kits and Reagents
  • Immune-Check Point
  • Tissue Microarray
  • Ligands and Inhibitors
  • Recombinant Proteins

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2021 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart