Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Cell Lines
    4. /
    5. Stable Cell Lines
    6. /
    7. GFP/VERO Stable Cell Line

    GFP/VERO Stable Cell Line

    Share:

    Fig-1: Analysis of the GFP/VERO stable cell line through fluorescence microscopy. Bright-field image (Left); Fluorescence image (Right).

    GFP/VERO Stable Cell Line
    GFP/VERO Stable Cell Line

    Roll over image to zoom in

       
    Fig-1:  Analysis of the GFP/VERO stable cell line through fluorescence microscopy. Bright-field image (Left); Fluorescence image (Right).
    Fig-2: Detection of GFP in the GFP/VERO stable cell line through flow cytometry . Parental Vero E6 cells (Green); GFP/VERO cells (Red).

    Product code: 14-902ACL

    Application : Functional Assay, FACS

    Shipping Info:

    Order now and get it on Tuesday August 16, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Local delivery areas

    Same-day delivery in San Diego available for the following zip codes:

    92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
    Download TDS / Manual MSDS
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    1 vial
    $2,750.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    Order now and get it on Tuesday August 16, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Download TDS / Manual MSDS

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 1 vial
    Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
    Storage condition : Immediately upon receipt, store in liquid nitrogen.

    GFP/VERO Stable Cell Line is  a stably transfected Vero E6 cell line which expresses enhanced green fluorescent protein (eGFP).

    Sequence data: Amino acid sequence of eGFP

    MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC
    TTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQE
    RTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNY
    NSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGP
    VLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

     

    Application:.

    •  Screen for GFP through Flow Cytometry. 
    •  Screen for GFP through Fluorescence Microscopy.

    Culture conditions:

    Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 5 µg/ml of Puromycin.
     
    It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Puromycin, spin down cells, resuspend cells in pre-warmed growth medium without Puromycin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
     
    Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Puromycin. Cells should be split before they reach complete confluence.
     
    To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
     
     
     

    LIMITED USE RESTRICTIONS:

    THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

    By use of this product, user agrees to be bound by the terms of this limited use statement.

    This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

    Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

     

     

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Recombinant Human Natural Cytotoxicity Triggering Receptor 1/NCR1/NKp46/CD335 (C-Fc)

    Recombinant Human Natural Cyto...

    details-Recombinant Human Natural Cytotoxicity Triggering Receptor 1/NCR1/NKp46/CD335 (C-Fc)
    Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) RPE(Discontinued)

    Anti-HSP90 beta Monoclonal Ant...

    details-Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) RPE(Discontinued)
    Recombinant Human Serum amyloid A-2 protein/SAA2(N-6His)

    Recombinant Human Serum amyloi...

    details-Recombinant Human Serum amyloid A-2 protein/SAA2(N-6His)
    Anti-Human CD279 FITC (Clone : EH12.2H7)

    Anti-Human CD279 FITC (Clone :...

    details-Anti-Human CD279 FITC (Clone : EH12.2H7)
    ENHO Recombinant Protein

    ENHO Recombinant Protein

    details-ENHO Recombinant Protein
    Recombinant Human Osteoprotegerin/OPG/TNFRSF11B (C-His)

    Recombinant Human Osteoprotege...

    details-Recombinant Human Osteoprotegerin/OPG/TNFRSF11B (C-His)
    Anti-MUC6 Monoclonal Antibody (Clone:IHC626)

    Anti-MUC6 Monoclonal Antibody ...

    details-Anti-MUC6 Monoclonal Antibody (Clone:IHC626)
    DNALI1 Recombinant Protein

    DNALI1 Recombinant Protein

    details-DNALI1 Recombinant Protein
    Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2/UBE2R2/UBC3B (N-6His)

    Recombinant Human Ubiquitin-Co...

    details-Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2/UBE2R2/UBC3B (N-6His)
    MIP-2 Leeporter™ Luciferase Reporter-HEK293 Cell Line

    MIP-2 Leeporter™ Luciferase ...

    details-MIP-2 Leeporter™ Luciferase Reporter-HEK293 Cell Line
    Recombinant Human NKG2C & CD94 Heterodimer

    Recombinant Human NKG2C & CD94...

    details-Recombinant Human NKG2C & CD94 Heterodimer
    Recombinant Mouse Trefoil Factor 1/TFF1 (C-6His)

    Recombinant Mouse Trefoil Fact...

    details-Recombinant Mouse Trefoil Factor 1/TFF1 (C-6His)
    CpG ODN (2216), TLR9 ligand (Class A)

    CpG ODN (2216), TLR9 ligand (C...

    details-CpG ODN (2216), TLR9 ligand (Class A)
    Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 11

    Recombinant Human DnaJ (Hsp40)...

    details-Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 11

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    CD80 Stable Cell Line

    CD80 Stable Cell Line

    G alpha 15 Stable Cell Line-IP1-CHO-K1-Human(Currently Unavailable)

    G alpha 15 Stable Cell Line-IP1-CHO-K1-Human(Currently Unavailable)

    G alpha 15 Stable Cell Line-SST4-CHO-K1-Human(Currently Unavailable)

    G alpha 15 Stable Cell Line-SST4-CHO-K1-Human(Currently Unavailable)

    New Products

    Recombinant Monkeypox virus A29 Protein

    Recombinant Monkeypox virus A29 Protein

    Anti-Ross River Virus (Clone: RRV-86)

    Anti-Ross River Virus (Clone: RRV-86)

    Anti-Respiratory Syncytial Virus (Clone: RSV-3M3)

    Anti-Respiratory Syncytial Virus (Clone: RSV-3M3)

    close

    Please Login to write a Review !!


    close

    GFP/VERO Stable Cell Line

    Product code: 14-902ACL
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart