Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. GH Rainbow Trout

    GH Rainbow Trout

    Share:

    GH Rainbow Trout

    Roll over image to zoom in

       

    Product code: 32-6377

    Application : Functional Assay

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price

    Available Pack Size(s)

    •   2 µg

    •  10 µg

    • $257.00 

    • $325.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 10 µg
    Purification : Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
    Content : The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8.
    It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100µg/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
    Storage condition : Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
    AA sequence : AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL.
    Alternative Name : GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
    Source: Escherichia Coli.
    Sterile Filtered White lyophilized (freeze-dried) powder.
    GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
    Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton. The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.

    Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    CES1G Mouse

    CES1G Mouse

    details-CES1G Mouse
    Fra e 1.0101

    Fra e 1.0101

    details-Fra e 1.0101
    TH Mouse

    TH Mouse

    details-TH Mouse
    PLAUR Human

    PLAUR Human

    details-PLAUR Human
    HIV-1 NEF Biotin

    HIV-1 NEF Biotin

    details-HIV-1 NEF Biotin
    Recombinant Human Neutrophil Cytosol Factor 1/ NCF1

    Recombinant Human Neutrophil C...

    details-Recombinant Human Neutrophil Cytosol Factor 1/ NCF1
    LDHA Rat

    LDHA Rat

    details-LDHA Rat
    KIR3DL2 Human

    KIR3DL2 Human

    details-KIR3DL2 Human
    Recombinant Human C-X-C Motif Chemokine 7/CXCL7/NAP-2 (C-6His)

    Recombinant Human C-X-C Motif ...

    details-Recombinant Human C-X-C Motif Chemokine 7/CXCL7/NAP-2 (C-6His)
    ATP1B1 Human, Sf9

    ATP1B1 Human, Sf9

    details-ATP1B1 Human, Sf9
    Recombinant Cynomolgus ICOS/AILIM/CD278 (C-Fc)

    Recombinant Cynomolgus ICOS/AI...

    details-Recombinant Cynomolgus ICOS/AILIM/CD278 (C-Fc)
    BETV6.0102

    BETV6.0102

    details-BETV6.0102
    NUBP1 Human

    NUBP1 Human

    details-NUBP1 Human
    Recombinant 2019-nCoV S Protein RBD (N501Y, C-Fc)

    Recombinant 2019-nCoV S Protei...

    details-Recombinant 2019-nCoV S Protein RBD (N501Y, C-Fc)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    CYP2E1 Human

    CYP2E1 Human

    TPA (311-562) Human

    TPA (311-562) Human

    CTLA4 Mouse

    CTLA4 Mouse

    New Products

    FGF1 Human, 154 a.a.

    FGF1 Human, 154 a.a.

    CDK5 Human, Sf9

    CDK5 Human, Sf9

    LUM Mouse

    LUM Mouse

    close

    Please Login to write a Review !!


    close

    GH Rainbow Trout

    Product code: 32-6377
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2021 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart