Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • Cell Lines
        • Primary Cells
        • Reporter Cell Lines
        • Stable Cell Lines
      • Kits and Reagents
        • Inhibitor Screening Kit
        • Molecular Biology Kits
        • ELISA Kits
        • Apoptosis Detection kits
        • Luciferase reporter assay kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Immune-Check Point
      • Tissue Microarray
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Cell Lines
  4. /
  5. Stable Cell Lines
  6. /
  7. hB7-H4 Stable Cell Line

hB7-H4 Stable Cell Line

Share:

Fig-1: Detection of human B7-H4 in the CHO-K1/hB7-H4 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/hB7-H4 cells (Red).

hB7-H4 Stable Cell Line

Roll over image to zoom in

   

Product code: 14-507ACL

Application : Functional Assay

Shipping Info:

Order now and get it on Tuesday January 19, 2021

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Local delivery areas

Same-day delivery in San Diego available for the following zip codes:

92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
Download TDS / Manual MSDS
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
1 Vial
$2,750.00 

Add to Wish List

Bulk Order

Shipping Info:

Order now and get it on Tuesday January 19, 2021

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Download TDS / Manual MSDS

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 1 Vial
Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Storage condition : Immediately upon receipt, store in liquid nitrogen.

hB7-H4 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human B7-H4, also known as VTCN1.

Sequence data: hB7-H4 (accession number NP_078902)

MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP
DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV
QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV
WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
 
 
 

Application:.

  •  Screen for antibodies of human B7-H4 through Flow Cytometry. 

Culture conditions:

Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
 
It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
 
Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.
 
To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
 
 
 

LIMITED USE RESTRICTIONS:

THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

By use of this product, user agrees to be bound by the terms of this limited use statement.

This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

 

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-CD79b (B-Cell Marker) Monoclonal Antibody(Clone: IGB/1843)

Anti-CD79b (B-Cell Marker) Mon...

details-Anti-CD79b (B-Cell Marker) Monoclonal Antibody(Clone: IGB/1843)
Simeprevir (sodium salt)

Simeprevir (sodium salt)

details-Simeprevir (sodium salt)
Mouse Monoclonal Antibody to Bi-Phospho-MET/HGFR(Y1234/Y1235) (Clone: 6AT1877)(Discontinued)

Mouse Monoclonal Antibody to B...

details-Mouse Monoclonal Antibody to Bi-Phospho-MET/HGFR(Y1234/Y1235) (Clone: 6AT1877)(Discontinued)
Recombinant Murine TFF-2(Discontinued)

Recombinant Murine TFF-2(Disco...

details-Recombinant Murine TFF-2(Discontinued)
Rabbit Polyclonal Antibody to Caspase 3(Discontinued)

Rabbit Polyclonal Antibody to ...

details-Rabbit Polyclonal Antibody to Caspase 3(Discontinued)
Flagellin

Flagellin

details-Flagellin
G alpha 15 Stable Cell Line-OPRM1-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-OP...

details-G alpha 15 Stable Cell Line-OPRM1-CHO-K1-Human(Currently Unavailable)
CTLA4 Stable Cell Line-CHO-K1-Cynomolgus(Currently Unavailable)

CTLA4 Stable Cell Line-CHO-K1-...

details-CTLA4 Stable Cell Line-CHO-K1-Cynomolgus(Currently Unavailable)
Anti-Cytokeratin 5/6/18 Monoclonal Antibody(Clone: SPM267)

Anti-Cytokeratin 5/6/18 Monocl...

details-Anti-Cytokeratin 5/6/18 Monoclonal Antibody(Clone: SPM267)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Peroxidase conjugated Goat anti Mouse IgG (H+L)

Peroxidase conjugated Goat anti Mou...

details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

Related Products

G alpha 15 Stable Cell Line-PAR2-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-PAR2-CHO-K1-Human(Currently Unavailable)

CD32C 13Gln Stable Cell Line-CHO-K1-Human(Currently Unavailable)

CD32C 13Gln Stable Cell Line-CHO-K1-Human(Currently Unavailable)

CD47 Stable Cell Line-CHO-K1-Mouse(Currently Unavailable)

CD47 Stable Cell Line-CHO-K1-Mouse(Currently Unavailable)

New Products

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

close

Please Login to write a Review !!


close

hB7-H4 Stable Cell Line

Product code: 14-507ACL
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • recmAb™
  • Cell Lines
  • Kits and Reagents
  • Immune-Check Point
  • Tissue Microarray
  • Ligands and Inhibitors
  • Recombinant Proteins

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2021 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart