Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. MMP9 Human, HEK

    MMP9 Human, HEK

    Share:

    MMP9 Human, HEK

    Roll over image to zoom in

       

    Product code: 32-6850

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price

    Available Pack Size(s)

    •   2 µg

    •  10 µg

    • $257.00 

    • $325.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Review   (0)
    Amount : 10 µg
    Purification : Greater than 95.0% as determined by SDS-PAGE.
    Content : MMP9 filtered (0.4 µm) and lyophilized from 0.5mg/ml solution in PBS, pH7.5 and 5% (w/v) Threalose.
    It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely.
    Storage condition : Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
    AA sequence : APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPET GELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAF ALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDD ELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFG FCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTR ADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQ GYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTT PQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAE IGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGAS VLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDHHHHHH.
    Alternative Name : Matrix metalloproteinase-9, MMP-9, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
    Source: HEK293 Cells.
    Filtered White lyophilized (freeze-dried) powder.
    Matrix metalloproteinases are a family of zinc and calcium-dependent endopeptidases that break down extracellular matrix proteins. The MMP9 is secreted as a 92kDa zymogen. Cleavage of ProMMP-9 results in the active enzyme, having a molecular weight of approximately 82kDa. MMP9 is composed of the following domains: a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by the several cell types: monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells. MMP9 is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 may also play an important part in local proteolysis of the extracellular matrix and in leukocyte migration, as well as in bone osteoclastic resorption. MMP9 cleaves type IV and type V collagens into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. MMP9 can also degrade fibronectin but not laminin or Pz-peptide.MMP9 defects may be a cause of susceptibility to intervertebral disc disease (IDD), also known as lumbar disk herniation (LDH).
    MMP9 Human Recombinant is a single, glycosylated polypeptide chain containing 694 amino acids (20-707a.a) and having a molecular mass of 77.2kDa (calculated). MMP9 is fused to a 6 a.a His tag at C-terminal.
    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    BETV4

    BETV4

    details-BETV4
    Recombinant Human Syntaxin-17

    Recombinant Human Syntaxin-17

    details-Recombinant Human Syntaxin-17
    Biotin Conjugated Anti-IFN-gamma Monoclonal Antibody (Clone:4S.B3)

    Biotin Conjugated Anti-IFN-gam...

    details-Biotin Conjugated Anti-IFN-gamma Monoclonal Antibody (Clone:4S.B3)
    Recombinant Human Leukocyte Mono Ig-Like Receptor 2/LMIR2/CD300C (C-Fc)

    Recombinant Human Leukocyte Mo...

    details-Recombinant Human Leukocyte Mono Ig-Like Receptor 2/LMIR2/CD300C (C-Fc)
    PPP1CC Human, Active

    PPP1CC Human, Active

    details-PPP1CC Human, Active
    IL10RA Human

    IL10RA Human

    details-IL10RA Human
    CoV-2 N (329 a.a.)

    CoV-2 N (329 a.a.)

    details-CoV-2 N (329 a.a.)
    ENTPD3 Human

    ENTPD3 Human

    details-ENTPD3 Human
    Recombinant Human R-Spondin-1/RSPO1 (C-6His)

    Recombinant Human R-Spondin-1/...

    details-Recombinant Human R-Spondin-1/RSPO1 (C-6His)
    GZMH Human

    GZMH Human

    details-GZMH Human
    VAMP2 (1-94) Human

    VAMP2 (1-94) Human

    details-VAMP2 (1-94) Human
    NECTIN2 Human

    NECTIN2 Human

    details-NECTIN2 Human
    AGA Human, sf9

    AGA Human, sf9

    details-AGA Human, sf9
    IMPAD1 Human, Active

    IMPAD1 Human, Active

    details-IMPAD1 Human, Active

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    APOE4 Human

    APOE4 Human

    CSF2RA Human, sf9

    CSF2RA Human, sf9

    IL1A Mouse, Sf9

    IL1A Mouse, Sf9

    New Products

    Anti-Henipavirus (Clone: HENV-117)

    Anti-Henipavirus (Clone: HENV-117)

    Anti-Eastern Equine Encephalitis Virus (Clone: EEEV-138)

    Anti-Eastern Equine Encephalitis Virus (Clone: EEEV-138)

    Recombinant MPXV A29L Protein, C-term His

    Recombinant MPXV A29L Protein, C-term His

    close

    Please Login to write a Review !!


    close

    MMP9 Human, HEK

    Product code: 32-6850
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart