Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Antibodies
  4. /
  5. Cancer Marker
  6. /
  7. Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1)

Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1)

Share:

Formalin-fixed, paraffin-embedded human GIST stained with DOG1 Monoclonal Antibody (DOG1.1).

Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1)

Roll over image to zoom in

   

Product code: 36-1581

Clone name : DOG-1.1
Clonality : Monoclonal
Application : IHC
Reactivity : Human

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS MSDS
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
100 µg
$499.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS MSDS

  • Product Info
  • Antigen Details
  • Description
  • Application Note
  • More
  • Review   (0)
Format : Purified
Amount : 100 µg
Isotype : Mouse IgG1, kappa
Purification : Affinity Chromatography
Content : 100 µg in 500 µl PBS containing 0.05% BSA and 0.05% sodium azide. Sodium azide is highly toxic.
Storage condition : Store the antibody at 4°C; stable for 6 months. For long-term storage; store at -20°C. Avoid repeated freeze and thaw cycles.
Gene : ANO1
Gene ID : 55107
Uniprot ID : Q5XXA6
Alternative Name : ANO1, DOG1, ORAOV2, TAOS2, TMEM16A
Immunogen Information : A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjµgated to a carrier protein.

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.

Immunohistology (Formalin-fixed) (1-2ug/ml for 30 minutes at RT),(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes),

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cell membrane, Cytoplasm
Tissue Specificity: Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles.
BioGrid: 120417. 1 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Human CD369 Antibody (Clone : 15E2)

Anti-Human CD369 Antibody (Clo...

details-Anti-Human CD369 Antibody (Clone : 15E2)
Polyclonal Antibody to ID2

Polyclonal Antibody to ID2

details-Polyclonal Antibody to ID2
Recombinant SARS-CoV-2 Spike RBD Protein, mFc tag

Recombinant SARS-CoV-2 Spike R...

details-Recombinant SARS-CoV-2 Spike RBD Protein, mFc tag
Anti-N-sulfated heparan sulfate Antibody (Clone : HepSS-1)

Anti-N-sulfated heparan sulfat...

details-Anti-N-sulfated heparan sulfate Antibody (Clone : HepSS-1)
Anti-CLDN18.2 (zolbetuximab biosimilar)

Anti-CLDN18.2 (zolbetuximab bi...

details-Anti-CLDN18.2 (zolbetuximab biosimilar)
Anti-TNFSF11 (denosumab biosimilar) mAb

Anti-TNFSF11 (denosumab biosim...

details-Anti-TNFSF11 (denosumab biosimilar) mAb
Monoclonal Antibody to human TLR4/MD-2 (Clone : 18H10)

Monoclonal Antibody to human T...

details-Monoclonal Antibody to human TLR4/MD-2 (Clone : 18H10)
Human Interleukin-22

Human Interleukin-22

details-Human Interleukin-22
Anti-Prostate Specific Antigen (PSA) Monoclonal Antibody(Clone: 3E6)

Anti-Prostate Specific Antigen...

details-Anti-Prostate Specific Antigen (PSA) Monoclonal Antibody(Clone: 3E6)
Mouse IgG control (Whole Molecule), Purified

Mouse IgG control (Whole Molec...

details-Mouse IgG control (Whole Molecule), Purified
LIPG HEK Recombinant Protein

LIPG HEK Recombinant Protein

details-LIPG HEK Recombinant Protein
Recombinant Human Myoglobin, His Tag

Recombinant Human Myoglobin, H...

details-Recombinant Human Myoglobin, His Tag
Anti-PSA Monoclonal Antibody (Clone:IHC654)

Anti-PSA Monoclonal Antibody (...

details-Anti-PSA Monoclonal Antibody (Clone:IHC654)
Anti-s-100 Monoclonal Antibody (Clone:IHC100)-Ready to Use

Anti-s-100 Monoclonal Antibody...

details-Anti-s-100 Monoclonal Antibody (Clone:IHC100)-Ready to Use

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Anti-CD8A (Cytotoxic / Suppressor T-Cell Marker) Monoclonal Antibody(Clone: T8/209)

Anti-CD8A (Cytotoxic / Suppressor T-Cell Marker) Monoclonal Antibody(Clone: T8/209)

Anti-CD31 / PECAM-1 (Endothelial Cell Marker) Monoclonal Antibody(Clone: PECAM1/3530)

Anti-CD31 / PECAM-1 (Endothelial Cell Marker) Monoclonal Antibody(Clone: PECAM1/3530)

Monoclonal Antibody to Carcinoembryonic Antigen (CEA) / CD66(Clone : C66/195)

Monoclonal Antibody to Carcinoembryonic Antigen (CEA) / CD66(Clone : C66/195)

New Products

HIV-1 gp41 Subtype-b

HIV-1 gp41 Subtype-b

Recombinant B.subtilis sfp (C-6His)

Recombinant B.subtilis sfp (C-6His)

Recombinant Human GAS6 (C-6His)

Recombinant Human GAS6 (C-6His)

close

Please Login to write a Review !!


close

Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1)

Product code: 36-1581
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart