Monoclonal Antibody to MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone : 2F6)

Product code: 36-1423

Clone name : 2F6
Clonality : Monoclonal
Application : WB, IHC
Reactivity : Human

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
100 µg
$560.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Format : Purified
Amount : 100 µg
Isotype : Mouse IgG2a, kappa
Purification : Affinity Chromatography
Content : 100 µg in 500 µl PBS containing 0.05% BSA and 0.05% sodium azide. Sodium azide is highly toxic.
Storage condition : Store the antibody at 4°C; stable for 6 months. For long-term storage; store at -20°C. Avoid repeated freeze and thaw cycles.
Gene : MAP3K1
Gene ID : 4214
Uniprot ID : Q13233
Alternative Name : MAP3K1, MAPKKK1, MEKK, MEKK1
Immunogen Information : Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFkB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Western Blot (1-2ug/ml);Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Post transnational modification: Autophosphorylated.
BioGrid: 110378. 137 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products