Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Cell Lines
  4. /
  5. Stable Cell Lines
  6. /
  7. NKp30 Stable Cell Line

NKp30 Stable Cell Line

Share:

Fig-1: Detection of human NKp30 in the CHO-K1/NKp30 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/NKp30 cells (Red).

NKp30 Stable Cell Line

Roll over image to zoom in

   

Product code: 14-511ACL

Application : Functional Assay

Shipping Info:

Order now and get it on Friday March 24, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Local delivery areas

Same-day delivery in San Diego available for the following zip codes:

92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
Download TDS / Manual MSDS
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
1 Vial
$2,750.00  $2,200.00 

Add to Wish List

Bulk Order

Shipping Info:

Order now and get it on Friday March 24, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Download TDS / Manual MSDS

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 1 Vial
Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Storage condition : Immediately upon receipt, store in liquid nitrogen.

NKp30 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human activating Natural Killer cell receptor 30 (NKp30, also known as Natural Cytotoxicity triggering Receptor 3 (NCR3) or CD337).

Sequence data: hNKp30 (accession number NP_667341)

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV
VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTG
NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV
PAPLPPPCGSSAHLLPPVPGG

 

Application:.

  •  Screen for antibodies of human NKp30 through Flow Cytometry. 

Culture conditions:

Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
 
It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
 
Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.
 
To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
 
 
 

LIMITED USE RESTRICTIONS:

THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

By use of this product, user agrees to be bound by the terms of this limited use statement.

This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

 

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-HSP90 alpha Monoclonal Antibody (Clone : Hyb-K41009) Alkaline Phosphatase(Discontinued)

Anti-HSP90 alpha Monoclonal An...

details-Anti-HSP90 alpha Monoclonal Antibody (Clone : Hyb-K41009) Alkaline Phosphatase(Discontinued)
Monoclonal Antibody to Kappa (Clone: ABM3A47)

Monoclonal Antibody to Kappa (...

details-Monoclonal Antibody to Kappa (Clone: ABM3A47)
Monoclonal Antibody to Rat C6 (clone: 3G11)

Monoclonal Antibody to Rat C6 ...

details-Monoclonal Antibody to Rat C6 (clone: 3G11)
Anti-Human CD143 Antibody (Clone : 5-369)

Anti-Human CD143 Antibody (Clo...

details-Anti-Human CD143 Antibody (Clone : 5-369)
Anti-Survivin Monoclonal Antibody (Clone:IHC668)

Anti-Survivin Monoclonal Antib...

details-Anti-Survivin Monoclonal Antibody (Clone:IHC668)
CD5L Recombinant Protein

CD5L Recombinant Protein

details-CD5L Recombinant Protein
Anti-CD40 Antibody (iscalimab biosimilar)(CFZ-533)

Anti-CD40 Antibody (iscalimab ...

details-Anti-CD40 Antibody (iscalimab biosimilar)(CFZ-533)
Anti-CS1 antibody(DM11), Rabbit mAb

Anti-CS1 antibody(DM11), Rabbi...

details-Anti-CS1 antibody(DM11), Rabbit mAb
Monoclonal Antibody to human ICAM-1

Monoclonal Antibody to human I...

details-Monoclonal Antibody to human ICAM-1
Monoclonal Antibody to CD10 (Clone: ABM4A52)

Monoclonal Antibody to CD10 (C...

details-Monoclonal Antibody to CD10 (Clone: ABM4A52)
TXNRD1 161-649 Recombinant Protein

TXNRD1 161-649 Recombinant Pro...

details-TXNRD1 161-649 Recombinant Protein
Monoclonal Antibody to human CD55

Monoclonal Antibody to human C...

details-Monoclonal Antibody to human CD55
AMBP Recombinant Protein

AMBP Recombinant Protein

details-AMBP Recombinant Protein
Recombinant Human X-Ray Repair Cross Complementing Protein 2

Recombinant Human X-Ray Repair...

details-Recombinant Human X-Ray Repair Cross Complementing Protein 2

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

G alpha 15 Stable Cell Line-H3-CHO-K1-Human(Currently Unavailable)

G alpha 15 Stable Cell Line-H3-CHO-K1-Human(Currently Unavailable)

CTLA4 Stable Cell Line

CTLA4 Stable Cell Line

hB7-H4 Stable Cell Line

hB7-H4 Stable Cell Line

New Products

Anti-IL-23 (Tremfya)(Guselkumab biosimilar) mAb

Anti-IL-23 (Tremfya)(Guselkumab biosimilar) mAb

Recombinant TLR5 Protein with human Fc Tag

Recombinant TLR5 Protein with human Fc Tag

Recombinant TLR9 Protein with human Fc Tag

Recombinant TLR9 Protein with human Fc Tag

close

Please Login to write a Review !!


close

NKp30 Stable Cell Line

Product code: 14-511ACL
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart