Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Cell Lines
  4. /
  5. Stable Cell Lines
  6. /
  7. ACE2/VERO Stable Cell Line

ACE2/VERO Stable Cell Line

Share:

Fig-1: Binding of biotinylated SARS-Cov-2 Spike RBD protein to human ACE2 in the ACE2/VERO stable cell line. ACE2/VERO cells were probed with different amounts of biotinylated SARS-Cov-2 Spike RBD protein (Abeomics, Cat. No. 21-1005-B) and analyzed through In-Cell ELISA using HRP-Streptavidin for detection.

ACE2/VERO Stable Cell Line
ACE2/VERO Stable Cell Line
ACE2/VERO Stable Cell Line
ACE2/VERO Stable Cell Line
ACE2/VERO Stable Cell Line

Roll over image to zoom in

   
Fig-1: Binding of biotinylated SARS-Cov-2 Spike RBD protein to human ACE2 in the ACE2/VERO stable cell line. ACE2/VERO cells were probed with different amounts of biotinylated SARS-Cov-2 Spike RBD protein (Abeomics, Cat. No. 21-1005-B) and analyzed through In-Cell ELISA using HRP-Streptavidin for detection.
Fig-2: Detection of ACE2 expression in ACE2/VERO cells by flow cytometry. ACE2/VERO cells were probed with biotinylated SARS-Cov-2 Spike RBD protein (Abeomics, Cat. No. 21-1005-B) at 1 x 10^5 cells per 1 µg protein on ice for 2 hours. Cells were washed with flow buffer and then incubated with PE-labeled Streptavidin on ice for 20 min. Cell were washed and then analyzed by flow cytometry.
Fig-3: Binding of biotinylated SARS-Cov-2 Spike RBD protein to human ACE2 in the ACE2/VERO stable cell line. ACE2/VERO cells were probed with different amounts of biotinylated SARS-Cov-2 Spike RBD protein (Abeomics, Cat. No. 21-1005-B) and analyzed by flow cytometry through fluorescent-labeled Streptavidin detection.
Fig-4: Genomic PCR analysis. Genomic DNAs were purified from ACE2/VERO stable cells and parental Vero E6 cells, and used as the PCR templates. PCR was performed using the target gene construct-specific primer sets, and the plasmid DNA of target gene construct was used as positive control.
Fig-5: Cell Surface staining of human ACE2 in the ACE2/VERO stable cell line. ATTO 488-conjugated anti-hACE2 antibody (clone AC18F; Abeomics, Cat. No.: 10-10031-AT488) was used at 1ug/ 1x10^6 cells (Red). ATTO 488-conjugated mouse IgG1 was used as isotype control at 1µg/ 1x10^6 cells (Green).

Product code: 14-525ACL

Application : Functional Assay

Shipping Info:

Order now and get it on Tuesday September 26, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Local delivery areas

Same-day delivery in San Diego available for the following zip codes:

92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
Download TDS / Manual MSDS
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
1 vial
$2,750.00  $2,200.00 

Add to Wish List

Bulk Order

Shipping Info:

Order now and get it on Tuesday September 26, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Download TDS / Manual MSDS

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 1 vial
Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Storage condition : Immediately upon receipt, store in liquid nitrogen.

ACE2/VERO Stable Cell Line is a stably transfected Vero E6 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal amino acid phenylalanine from angiotensin II and hydrolyses it into the vasodilator angiotensin. ACE2 also serves as an entry receptor for some coronaviruses including HCoV-NL63, SARS-CoV and SARS-CoV-2 as the virus that causes COVID-19.

Sequence data: hACE2 (accession number NP_068576)

MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSS
LASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNE
RLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYS
RGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWT
NLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLT
DPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLL
RNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTL
PFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSN
DYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPW
TLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISL
KSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFN
FFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVS
IWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNT
DDVQTSF
 

 

Application:.

  •  Screen for antibodies of human ACE2 through Flow Cytometry. 
  •  Protein binding study.

Culture conditions:

Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 250 µg/ml of Hygromycin.
 
It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Hygromycin, spin down cells, resuspend cells in pre-warmed growth medium without Hygromycin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
 
Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Hygromycin. Cells should be split before they reach complete confluence.
 
To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
 
 
 

LIMITED USE RESTRICTIONS:

THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

By use of this product, user agrees to be bound by the terms of this limited use statement.

This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

 

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Recombinant human IL21R protein with C-terminal human Fc tag

Recombinant human IL21R protei...

details-Recombinant human IL21R protein with C-terminal human Fc tag
Anti-CD123 antibody(DM31), Rabbit mAb

Anti-CD123 antibody(DM31), Rab...

details-Anti-CD123 antibody(DM31), Rabbit mAb
Monoclonal Antibody to mouse PECAM-1- MEC7.46

Monoclonal Antibody to mouse P...

details-Monoclonal Antibody to mouse PECAM-1- MEC7.46
Anti-CD22 antibody(DM14), Rabbit mAb

Anti-CD22 antibody(DM14), Rabb...

details-Anti-CD22 antibody(DM14), Rabbit mAb
mProcalcitonin Recombinant Protein

mProcalcitonin Recombinant Pro...

details-mProcalcitonin Recombinant Protein
Anti-beta-Actin Monoclonal Antibody (Clone: AC-15)

Anti-beta-Actin Monoclonal Ant...

details-Anti-beta-Actin Monoclonal Antibody (Clone: AC-15)
Anti-IDH1 R132H Monoclonal Antibody (Clone:IHC132)-Ready to Use

Anti-IDH1 R132H Monoclonal Ant...

details-Anti-IDH1 R132H Monoclonal Antibody (Clone:IHC132)-Ready to Use
Anti-BG8 LewisY Monoclonal Antibody (Clone:IHC517)

Anti-BG8 LewisY Monoclonal Ant...

details-Anti-BG8 LewisY Monoclonal Antibody (Clone:IHC517)
Anti-CS1 antibody(DM10), Rabbit mAb

Anti-CS1 antibody(DM10), Rabbi...

details-Anti-CS1 antibody(DM10), Rabbit mAb
Rabbit Polyclonal Antibody to Histone H4(Discontinued)

Rabbit Polyclonal Antibody to ...

details-Rabbit Polyclonal Antibody to Histone H4(Discontinued)
Anti-Human CD34 PE-DyLight® 594 (Clone : 4H11[APG])

Anti-Human CD34 PE-DyLight® 5...

details-Anti-Human CD34 PE-DyLight® 594 (Clone : 4H11[APG])
Anti-Thyrotropin (hTSH) Monoclonal Antibody (Clone:TSH-116)

Anti-Thyrotropin (hTSH) Monocl...

details-Anti-Thyrotropin (hTSH) Monoclonal Antibody (Clone:TSH-116)
SARS-CoV-2 (2019-nCoV) Spike Protein (S2 ECD, His tag)

SARS-CoV-2 (2019-nCoV) Spike P...

details-SARS-CoV-2 (2019-nCoV) Spike Protein (S2 ECD, His tag)
Anti-beta-tubulin Monoclonal Antibody (Clone:TU-06)

Anti-beta-tubulin Monoclonal A...

details-Anti-beta-tubulin Monoclonal Antibody (Clone:TU-06)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

NKp30 Stable Cell Line

NKp30 Stable Cell Line

CD80 Stable Cell Line

CD80 Stable Cell Line

SIGLEC9 Stable Cell Line

SIGLEC9 Stable Cell Line

New Products

Monoclonal Antibody to CD69 (Clone: ABM39A4) BSA Free

Monoclonal Antibody to CD69 (Clone: ABM39A4) BSA Free

Anti-Hu CD156c PE Mab(11G2)

Anti-Hu CD156c PE Mab(11G2)

Anti-Bcl-6 (Follicular Lymphoma Marker) Monoclonal Antibody(Clone: BCL6/1527) BSA/Azide Free

Anti-Bcl-6 (Follicular Lymphoma Marker) Monoclonal Antibody(Clone: BCL6/1527) BSA/Azide Free

close

Please Login to write a Review !!


close

ACE2/VERO Stable Cell Line

Product code: 14-525ACL
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart