Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • Cell Lines
        • Primary Cells
        • Reporter Cell Lines
        • Stable Cell Lines
      • Kits and Reagents
        • Inhibitor Screening Kit
        • Molecular Biology Kits
        • ELISA Kits
        • Apoptosis Detection kits
        • Luciferase reporter assay kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Immune-Check Point
      • Tissue Microarray
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. pGM CSF Recombinant Protein

pGM CSF Recombinant Protein

Share:

pGM CSF Recombinant Protein

Roll over image to zoom in

   

Product code: 32-1290

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
20µg
$325.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Review   (0)
Amount : 20µg
Purification : Greater than 90.0% as determined by SDS-PAGE.
Content : MIF protein solution (1mg/ml) containing Phosphate Buffered Saline (pH7.4) and 10% glycerol.
Storage condition : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
AA sequence : MSPILGYWKIKGLVQPTRLL LEYLEEKYEE HLYERDEGDK WRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHNMLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTHPDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIA WPLQGWQATF GGGDHPPKSDLVPRGSPEFAMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC SLHSIGKIGGAQNRSYSKLL CGLLAERLRI SPDRVYINYY DMNAANVGWN NSTFA.
Alternative Name : Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor), Phenylpyruvate Tautomerase, L-Dopachrome Tautomerase, L-Dopachrome Isomerase, GLIF, MMIF, GIF, Macrophage Migration Inhibitory Factor, Glycosylation-Inhibiting Factor, EC 5.3

Source : Escherichia Coli. MIF Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 345 amino acids (1-115 a.a) and having a molecular mass of 39.2kDa. MIF is fused to a 230 amino acid GST-tag at N-terminus & purified by proprietary chromatographic techniques. The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-STAT5B Monoclonal Antibody(Clone: STAT5B/2611)

Anti-STAT5B Monoclonal Antibod...

details-Anti-STAT5B Monoclonal Antibody(Clone: STAT5B/2611)
Anti-SOX10 (Melanoma Marker) Monoclonal Antibody(Clone: SOX10/2311R)

Anti-SOX10 (Melanoma Marker) M...

details-Anti-SOX10 (Melanoma Marker) Monoclonal Antibody(Clone: SOX10/2311R)
Recombinant Hepatitis C Virus NS5 Genotype-6a

Recombinant Hepatitis C Virus ...

details-Recombinant Hepatitis C Virus NS5 Genotype-6a
Anti-Prolactin Receptor (hPRL Receptor) Monoclonal Antibody(Clone: rPRLR/742)

Anti-Prolactin Receptor (hPRL ...

details-Anti-Prolactin Receptor (hPRL Receptor) Monoclonal Antibody(Clone: rPRLR/742)
Monoclonal antibody to S100A4 (Clone: ABM48F7)

Monoclonal antibody to S100A4 ...

details-Monoclonal antibody to S100A4 (Clone: ABM48F7)
Anti-SOX10 (Melanoma Marker) Monoclonal Antibody(Clone: SPM607)

Anti-SOX10 (Melanoma Marker) M...

details-Anti-SOX10 (Melanoma Marker) Monoclonal Antibody(Clone: SPM607)
Anti-CD34 (Hematopoietic Stem Cell & Endothelial Marker) Monoclonal Antibody(Clone: HPCA1/2598R)

Anti-CD34 (Hematopoietic Stem ...

details-Anti-CD34 (Hematopoietic Stem Cell & Endothelial Marker) Monoclonal Antibody(Clone: HPCA1/2598R)
Anti-Parathyroid Hormone (PTH) (N-Terminal) Monoclonal Antibody(Clone: PTH/1717R)

Anti-Parathyroid Hormone (PTH)...

details-Anti-Parathyroid Hormone (PTH) (N-Terminal) Monoclonal Antibody(Clone: PTH/1717R)
Anti-CD1a / HTA1 (Mature Langerhans Cells Marker) Monoclonal Antibody(Clone: C1A/1506R)

Anti-CD1a / HTA1 (Mature Lange...

details-Anti-CD1a / HTA1 (Mature Langerhans Cells Marker) Monoclonal Antibody(Clone: C1A/1506R)
Anti-CD3e (T-Cell Marker) Monoclonal Antibody(Clone: C3e/3125R)

Anti-CD3e (T-Cell Marker) Mono...

details-Anti-CD3e (T-Cell Marker) Monoclonal Antibody(Clone: C3e/3125R)
Anti-SOX9 / SRY-box 9 Monoclonal Antibody(Clone: SOX9/2287R)

Anti-SOX9 / SRY-box 9 Monoclon...

details-Anti-SOX9 / SRY-box 9 Monoclonal Antibody(Clone: SOX9/2287R)
Anti-Parathyroid Hormone (PTH) (N-Terminal) Polyclonal Antibody

Anti-Parathyroid Hormone (PTH)...

details-Anti-Parathyroid Hormone (PTH) (N-Terminal) Polyclonal Antibody
Anti-Prolactin Receptor (hPRL Receptor) Monoclonal Antibody(Clone: PRLR/3785R)

Anti-Prolactin Receptor (hPRL ...

details-Anti-Prolactin Receptor (hPRL Receptor) Monoclonal Antibody(Clone: PRLR/3785R)
Anti-Beta-2 Microglobulin (Renal Failure & Tumor Marker) Monoclonal Antibody(Clone: 246-E9.E7; same as HLA.ABC.m2)

Anti-Beta-2 Microglobulin (Ren...

details-Anti-Beta-2 Microglobulin (Renal Failure & Tumor Marker) Monoclonal Antibody(Clone: 246-E9.E7; same as HLA.ABC.m2)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Peroxidase conjugated Goat anti Mouse IgG (H+L)

Peroxidase conjugated Goat anti Mou...

details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

Related Products

Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1/CDK2AP1 (C-6His)(Discontinued)

Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1/CDK2AP1 (C-6His)(Discontinued)

Human GDF-15/MIC-1 (Cell Culture derived)(Discontinued)

Human GDF-15/MIC-1 (Cell Culture derived)(Discontinued)

Human Monocyte Chemotactic Protein-1 (CCL2)

Human Monocyte Chemotactic Protein-1 (CCL2)

New Products

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 Spike S1 Mutant Sampler Set

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(D614G)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

SARS-CoV-2 (2019-nCoV) Spike S1(N439K)- His Tag Protein

close

Please Login to write a Review !!


close

pGM CSF Recombinant Protein

Product code: 32-1290
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • recmAb™
  • Cell Lines
  • Kits and Reagents
  • Immune-Check Point
  • Tissue Microarray
  • Ligands and Inhibitors
  • Recombinant Proteins

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2021 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart