Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B/OX40L(N-8His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHHHQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Source: Human cells.
MW :16.5kD.
Recombinant Cynomolgus monkey OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 8His tag at the N-terminus. Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40 which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells. It is a cytokine that binds to TNFRSF4, Co-stimulates T-cell proliferation and cytokine production. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells.
MW :16.5kD.
Recombinant Cynomolgus monkey OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 8His tag at the N-terminus. Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40 which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells. It is a cytokine that binds to TNFRSF4, Co-stimulates T-cell proliferation and cytokine production. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|

















.png)









