Recombinant Human 14-3-3 Protein e/YWHAE (N-GST)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ |
Source: E.coli.
MW :56kD.
Recombinant Human 14-3-3 Protein epsilon is produced by our E.coli expression system and the target gene encoding Met1-Gln255 is expressed with a GST tag at the N-terminus. 14-3-3 Protein Epsilon acts as an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. 14-3-3 protein epsilon binds to a large number of partners, usually by recognition of a phophoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
MW :56kD.
Recombinant Human 14-3-3 Protein epsilon is produced by our E.coli expression system and the target gene encoding Met1-Gln255 is expressed with a GST tag at the N-terminus. 14-3-3 Protein Epsilon acts as an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. 14-3-3 protein epsilon binds to a large number of partners, usually by recognition of a phophoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm, Melanosome |
| BioGrid: | 113363. 418 interactions. |
|
There are currently no product reviews
|

















.png)










