Recombinant Human a-Lactalbumin/LALBA (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,PH8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHHH |
Source: Human Cells.
MW :15.1kD.
Recombinant Human alpha-lactalbumin is produced by our Mammalian expression system and the target gene encoding Lys20-Leu142 is expressed with a 6His tag at the C-terminus. Alpha-lactalbumin(LALBA) is a secreted protein that is a member of the glycosyl hydrolase 22 family.It is expressed in mammary gland in milk. It is the regulatory subunit of lactose synthase.It changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme.
MW :15.1kD.
Recombinant Human alpha-lactalbumin is produced by our Mammalian expression system and the target gene encoding Lys20-Leu142 is expressed with a 6His tag at the C-terminus. Alpha-lactalbumin(LALBA) is a secreted protein that is a member of the glycosyl hydrolase 22 family.It is expressed in mammary gland in milk. It is the regulatory subunit of lactose synthase.It changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Mammary gland specific. Secreted in milk. |
| BioGrid: | 110101. 5 interactions. |
|
There are currently no product reviews
|
















.png)









