Recombinant Human Nucleoside Diphosphate Kinase A/NDPKA (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
Source: E.coli.
MW :19.3kD.
Recombinant Human Nucleoside Diphosphate Kinase A is produced by our E.coli expression system and the target gene encoding Met1-Glu152 is expressed with a 6His tag at the N-terminus. Nucleoside-Diphosphate Kinases (NDKs) are enzymes that catalyze the exchange of phosphate groups between different nucleoside diphosphates. NDKs Possesse nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3-5 exonuclease activities. NDKs involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression and required for neural development including neural patterning and cell fate determination. Prokaryotic NDK forms a functional homotetramer.There are two isoforms of NDK in humans: NDK-A and NDK-B. Both have very similar structure, and can combine in any proportion to form functional NDK hexamers.
MW :19.3kD.
Recombinant Human Nucleoside Diphosphate Kinase A is produced by our E.coli expression system and the target gene encoding Met1-Glu152 is expressed with a 6His tag at the N-terminus. Nucleoside-Diphosphate Kinases (NDKs) are enzymes that catalyze the exchange of phosphate groups between different nucleoside diphosphates. NDKs Possesse nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3-5 exonuclease activities. NDKs involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression and required for neural development including neural patterning and cell fate determination. Prokaryotic NDK forms a functional homotetramer.There are two isoforms of NDK in humans: NDK-A and NDK-B. Both have very similar structure, and can combine in any proportion to form functional NDK hexamers.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus |
| Tissue Specificity: | Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation. |
| BioGrid: | 110894. 63 interactions. |
|
There are currently no product reviews
|

















.png)







