Recombinant Human a-N-Acetylneuraminide a-2,8-Sialyltransferase/ST8SIA1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTSVDHHHHHH |
Source: Human Cells.
MW :36.2kD.
Recombinant Human ST8SIA1 is produced by our Mammalian expression system and the target gene encoding Tyr49-Ser356 is expressed with a 6His tag at the C-terminus. a-N-Acetylneuraminide a-2,8-Sialyltransferase (ST8SIA1) belongs to the glycosyltransferase 29 family. ST8SIA1 is a sialytransferase that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce GD3 and GT3. ST8SIA1 is highly expressed in melanoma cell lines, adult and fetal brain, low expressed in adult and fetal lung. ST8SIA1 may act as a type II transmembrane protein with a short N-termianl cytoplasmic domain and a single-pass transmembrane domain folowed by an enzymatic domain in the lument of the Golgi apparatus.
MW :36.2kD.
Recombinant Human ST8SIA1 is produced by our Mammalian expression system and the target gene encoding Tyr49-Ser356 is expressed with a 6His tag at the C-terminus. a-N-Acetylneuraminide a-2,8-Sialyltransferase (ST8SIA1) belongs to the glycosyltransferase 29 family. ST8SIA1 is a sialytransferase that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce GD3 and GT3. ST8SIA1 is highly expressed in melanoma cell lines, adult and fetal brain, low expressed in adult and fetal lung. ST8SIA1 may act as a type II transmembrane protein with a short N-termianl cytoplasmic domain and a single-pass transmembrane domain folowed by an enzymatic domain in the lument of the Golgi apparatus.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Golgi apparatus membrane |
| Tissue Specificity: | Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung. |
| BioGrid: | 112380. 10 interactions. |
|
There are currently no product reviews
|










.png)










