Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH/ARH1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL |
Source: E.coli.
MW :41.67kD.
Recombinant Human ADP-Ribosylarginine Hydrolase is produced by our E.coli expression system and the target gene encoding Met1-Leu357 is expressed with a 6His tag at the N-terminus. ADP-Ribosylarginine Hydrolase (ADPRH) belongs to the ADP-Ribosylglycohydrolase family. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-Ribosylation cycle, which is a post-translation modification that includes the addition of one or more ADP-ribose moieties. These reactions are related to cell signaling and the control of many cell processes, such as DNA repair and cell apoptosis. In addition, ADPRH binds with magnesium ion and possess ADP-ribosylarginine hydrolase activity.
MW :41.67kD.
Recombinant Human ADP-Ribosylarginine Hydrolase is produced by our E.coli expression system and the target gene encoding Met1-Leu357 is expressed with a 6His tag at the N-terminus. ADP-Ribosylarginine Hydrolase (ADPRH) belongs to the ADP-Ribosylglycohydrolase family. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-Ribosylation cycle, which is a post-translation modification that includes the addition of one or more ADP-ribose moieties. These reactions are related to cell signaling and the control of many cell processes, such as DNA repair and cell apoptosis. In addition, ADPRH binds with magnesium ion and possess ADP-ribosylarginine hydrolase activity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 106651. 10 interactions. |
|
There are currently no product reviews
|











.png)











