Recombinant Human Aldehyde Dehydrogenase 1-A1/ALDH1A1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,pH8.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS |
Source: E. coli.
MW :57kD.
Recombinant Human Aldehyde Dehydrogenase 1-A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser501 is expressed with a 6His tag at the N-terminus. Aldehyde Dehydrogenase Family 1 Member A1 (ALDH1A1) is a cytoplasmic enzyme that belongs to the Aldehyde Dehydrogenase family. ALDH1A1 is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties and subcellular localizations. ALDH1A1 is the main cytosolic isoform, which has a lower affinity for aldehydes than the mitochondrial enzyme. ALDH1A1 binds free retinal and cellular retinol-binding protein-bound retinal. It can convert/oxidize retinaldehyde to retinoic acid.
MW :57kD.
Recombinant Human Aldehyde Dehydrogenase 1-A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser501 is expressed with a 6His tag at the N-terminus. Aldehyde Dehydrogenase Family 1 Member A1 (ALDH1A1) is a cytoplasmic enzyme that belongs to the Aldehyde Dehydrogenase family. ALDH1A1 is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties and subcellular localizations. ALDH1A1 is the main cytosolic isoform, which has a lower affinity for aldehydes than the mitochondrial enzyme. ALDH1A1 binds free retinal and cellular retinol-binding protein-bound retinal. It can convert/oxidize retinaldehyde to retinoic acid.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Post transnational modification: | The N-terminus is blocked most probably by acetylation. |
| BioGrid: | 106718. 6 interactions. |
|
There are currently no product reviews
|
















.png)








