Recombinant Human Apoptosis Regulator Bcl-2 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM HEPES, 150mM NaCl, 10%Glycerol, pH8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDHHHHHH |
Source: E.coli.
MW :24.1kD.
Recombinant Human Apoptosis Regulator Bcl-2 is produced by our E.coli expression system and the target gene encoding Met1-Asp211 is expressed with a 6His tag at the C-terminus. Bcl-2 is a member of a family of proteins that regulates outer mitochondrial membrane permeability. Bcl-2 is an antiapoptotic member that prevents release of cytochrome c from the mitochondria intermembrane space into the cytosol. Bcl-2 is present on the outer mitochondrial membrane and is also found on other membranes in some cell types. BCL-2 is localized to the outer membrane of mitochondria,where it plays an important role in promoting cellular survival and inhibiting the actions of pro-apoptotic proteins. The pro-apoptotic proteins in the BCL-2 family, including Bax and Bak, normally act on the mitochondrial membrane to promote permeabilization and release of cytochrome C and ROS, that are important signals in the apotosis cascade. These pro-apoptotic proteins are in turn activated by BH3-only proteins, and are inhibited by the function of BCL-2 and its relative BCL-Xl.
MW :24.1kD.
Recombinant Human Apoptosis Regulator Bcl-2 is produced by our E.coli expression system and the target gene encoding Met1-Asp211 is expressed with a 6His tag at the C-terminus. Bcl-2 is a member of a family of proteins that regulates outer mitochondrial membrane permeability. Bcl-2 is an antiapoptotic member that prevents release of cytochrome c from the mitochondria intermembrane space into the cytosol. Bcl-2 is present on the outer mitochondrial membrane and is also found on other membranes in some cell types. BCL-2 is localized to the outer membrane of mitochondria,where it plays an important role in promoting cellular survival and inhibiting the actions of pro-apoptotic proteins. The pro-apoptotic proteins in the BCL-2 family, including Bax and Bak, normally act on the mitochondrial membrane to promote permeabilization and release of cytochrome C and ROS, that are important signals in the apotosis cascade. These pro-apoptotic proteins are in turn activated by BH3-only proteins, and are inhibited by the function of BCL-2 and its relative BCL-Xl.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion outer membrane, Nucleus membrane, Endoplasmic reticulum membrane |
| Post transnational modification: | Monoubiquitinated by PRKN, leading to increase its stability. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome. |
| Tissue Specificity: | Expressed in a variety of tissues. |
| BioGrid: | 107068. 102 interactions. |
|
There are currently no product reviews
|
















.png)







