Recombinant Human Apolipoprotein H/ApoH (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPCVDHHHHHH |
Source: Human Cells.
MW :37.29kD.
Recombinant Human Apolipoprotein H is produced by our Mammalian expression system and the target gene encoding Gly20-Ser345 is expressed with a 6His tag at the C-terminus. Apolipoprotein H (ApoH) is a 50 kDa variably glycosylated member of the complement control superfamily of proteins. Human ApoH is a major phospholipid binding protein and an important component to measure in the assessment of anti-phospholipid syndrome. Hepatocyte-derived ApoH binds to negatively charged phospholipids . It circulates as a component of lipoprotein particles and as a lipid-free serum protein. Human ApoH is also more specific than anti-cardiolipin antibodies and its presence correlates better with thrombotic risk. Mature human ApoH shares 76% and 82% aa sequence identity with mouse and rat ApoH.
MW :37.29kD.
Recombinant Human Apolipoprotein H is produced by our Mammalian expression system and the target gene encoding Gly20-Ser345 is expressed with a 6His tag at the C-terminus. Apolipoprotein H (ApoH) is a 50 kDa variably glycosylated member of the complement control superfamily of proteins. Human ApoH is a major phospholipid binding protein and an important component to measure in the assessment of anti-phospholipid syndrome. Hepatocyte-derived ApoH binds to negatively charged phospholipids . It circulates as a component of lipoprotein particles and as a lipid-free serum protein. Human ApoH is also more specific than anti-cardiolipin antibodies and its presence correlates better with thrombotic risk. Mature human ApoH shares 76% and 82% aa sequence identity with mouse and rat ApoH.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed by the liver and secreted in plasma. |
| BioGrid: | 106847. 13 interactions. |
|
There are currently no product reviews
|












.png)








