Recombinant Human Autophagy Related 4 Homolog C/ATG4C (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLLLEHHHHHH |
Source: E.coli.
MW :53.56kD.
Recombinant Human Autophagy protein 4C is produced by our E.coli expression system and the target gene encoding Met1-Leu458 is expressed with a 6His tag at the C-terminus. Cysteine Protease ATG4C (ATG4C) belongs to the peptidase C54 family. It is required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form which is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ATG4C is a cytoplasmic protein and high expressed in skeletal muscle, liver, testis and heart. ATG4C can be inhibited by N-ethylmaleimide.
MW :53.56kD.
Recombinant Human Autophagy protein 4C is produced by our E.coli expression system and the target gene encoding Met1-Leu458 is expressed with a 6His tag at the C-terminus. Cysteine Protease ATG4C (ATG4C) belongs to the peptidase C54 family. It is required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form which is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ATG4C is a cytoplasmic protein and high expressed in skeletal muscle, liver, testis and heart. ATG4C can be inhibited by N-ethylmaleimide.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Highly expressed in skeletal muscle, heart, liver and testis. |
| BioGrid: | 124372. 28 interactions. |
|
There are currently no product reviews
|














.png)







