Recombinant Human beta-Galactoside a-2,6-Sialyltransferase 1/ST6GAL1 (C-6His)
Figure 1: Coomassie staining of Recombinant Human beta-Galactoside a-2,6-Sialyltransferase 1/ST6GAL1 (C-6His).
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHCVDHHHHHH |
Source: Human Cells.
MW :44.6kD.
Recombinant Human ST6GAL1 is produced by our Mammalian expression system and the target gene encoding Lys27-Cys406 is expressed with a 6His tag at the C-terminus. The ST6GAL1 gene encodes beta-Galactosamide a-2,6-Sialyltransferase 1. It is a type II membrane protein and is localized to the trans-Golgi network. It catalyzes 2,6-sialylation of Gal beta1,4-GlcNAc structures on N-glycans. ST6GAL1 is highly expressed in the liver and other tissues. ST6GAL1 deficiency causes abnormalities in B-cell immunoreactivity. The expression and activity of ST6GAL1 are associated with tumor metastasis in breast and colon cancers. The majority of ST6GAL1 in the liver is cleaved and secreted into the serum and may be used as a biomarker for hepatitis diseases.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Golgi apparatus, Secreted |
| Post transnational modification: | The HB-6, CDW75, and CD76 differentiation antigens are cell-surface carbohydrate determinants generated by this enzyme. |
| BioGrid: | 112374. 20 interactions. |
|
There are currently no product reviews
|














.png)









