Recombinant Human beta-Lactamase-Like Protein 2/LACTB2 (N-GST)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL |
Source: E.coli.
MW :59.24kD.
Recombinant Human LACTB2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a GST tag at the N-terminus. beta-Lactamase-like Protein 2 (LACTB2) is a number of the metallo-beta-lactamase superfamily.LACTB2 also belongs to the Glyoxalase II family. LACTB2 is 288 amino acids long with 8 zinc-binding domains. The LACTB2 gene is expressed at high levels and annotates structural defects or features in 4 cDNA clones. LACTB2 proteins are expected to have hydrolase activity and metal ion-binding functions. LACTB2 protein is found to localize in mitochondrion. Other functions of LACTB2 is yet unknown.
MW :59.24kD.
Recombinant Human LACTB2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a GST tag at the N-terminus. beta-Lactamase-like Protein 2 (LACTB2) is a number of the metallo-beta-lactamase superfamily.LACTB2 also belongs to the Glyoxalase II family. LACTB2 is 288 amino acids long with 8 zinc-binding domains. The LACTB2 gene is expressed at high levels and annotates structural defects or features in 4 cDNA clones. LACTB2 proteins are expected to have hydrolase activity and metal ion-binding functions. LACTB2 protein is found to localize in mitochondrion. Other functions of LACTB2 is yet unknown.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion matrix |
| BioGrid: | 119299. 20 interactions. |
|
There are currently no product reviews
|















.png)










