Recombinant Human BNIP3/NIP3 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV |
Source: E. coli.
MW :20.6kD.
Recombinant Human BNIP3 is produced by our E.coli expression system and the target gene encoding Met1-Leu166 is expressed with a 6His tag at the N-terminus. BCL2/Adenovirus E1B 19 kDa Protein-Iinteracting Protein 3 (BNIP3) is a single-pass membrane protein. BNIP3 is a member of the NIP3 family. BNIP3 contains a single Bcl-2 homology 3 domain and interacts with the E1B 19 kDa protein. BNIP3 have been associated with pro-apoptotic function. BNIP3 is an apoptosis-inducing protein that can overcome BCL2 suppression. It plays a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. BNIP3 involved in mitochondrial quality control via its interaction with SPATA18/MIEAP, response to mitochondrial damage, participates to mitochondrial protein catabolic process.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion, Mitochondrion outer membrane |
| BioGrid: | 107132. 26 interactions. |
|
There are currently no product reviews
|








.png)









