Recombinant Human BOC Protein/BOC (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSVDHHHHHH |
Source: Human Cells.
MW :14.2kD.
Recombinant Human BOC is produced by our Mammalian expression system and the target gene encoding Asp31-Ser157 is expressed with a 6His tag at the C-terminus. Brother of CDO is a protein that in humans is encoded by the BOC gene. CDON and BOC are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.
MW :14.2kD.
Recombinant Human BOC is produced by our Mammalian expression system and the target gene encoding Asp31-Ser157 is expressed with a 6His tag at the C-terminus. Brother of CDO is a protein that in humans is encoded by the BOC gene. CDON and BOC are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|










.png)












