Recombinant Rabbit Tumor Necrosis Factor a/TNF-a
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 300mM NaCl, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL |
Source: E.coli.
MW :17.59kD.
Recombinant Rabbit Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Val77-Leu235 is expressed. Tumor necrosis factor alpha (TNFa) is the prototypic ligand of the TNF superfamily. TNFa forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1,p55R) and TNF-R2 (TNF receptor type 2,p75R). TNFa is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFa is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.
MW :17.59kD.
Recombinant Rabbit Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Val77-Leu235 is expressed. Tumor necrosis factor alpha (TNFa) is the prototypic ligand of the TNF superfamily. TNFa forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1,p55R) and TNF-R2 (TNF receptor type 2,p75R). TNFa is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFa is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid. |
|
There are currently no product reviews
|












.png)








