Recombinant Human C-C Motif Chemokine 1/CCL1(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Source: E.coli.
MW :8.62kD.
Recombinant Human C-C Motif Chemokine 1 is produced by our E.coli expression system and the target gene encoding Lys24-Lys96 is expressed. Chemokine (C-C Motif) Ligand 1 (CCL1) is a small glycoprotein secreted by activated T cells, which play a central role during immunoregulatory and inflammaion processes. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with cell surface chemokine receptor CCR8. CCL1 is identified as a potent inhibitor of HIV-1 envelope-mediated cell-cell fusion and virus infection.
MW :8.62kD.
Recombinant Human C-C Motif Chemokine 1 is produced by our E.coli expression system and the target gene encoding Lys24-Lys96 is expressed. Chemokine (C-C Motif) Ligand 1 (CCL1) is a small glycoprotein secreted by activated T cells, which play a central role during immunoregulatory and inflammaion processes. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with cell surface chemokine receptor CCR8. CCL1 is identified as a potent inhibitor of HIV-1 envelope-mediated cell-cell fusion and virus infection.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|
















.png)










