Recombinant Human C-C Motif Chemokine 26/CCL26 (24-94)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 1mM EDTA, 20% Glycerol, pH 9.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MTRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
Source: E.coli.
MW :8.53kD.
Recombinant Human C-C Motif Chemokine 26 is produced by our E.coli expression system and the target gene encoding Thr24-Leu94 is expressed. Chemokine Ligand 26 protein (CCL26) is a novel small cytokine belonging to the CC chemokine family which is involved in immunoregulatory and inflammatory processes. CCL26 is constitutively expressed in thymus, but only transiently expressed in phytohemagglutinin-stimulated peripheral blood mononuclear cells. It specifically binds and induces chemotaxis in T cells and elicits its effects by interacting with the chemokine receptor CCR4. CCL26, along with Eotaxin-1 and Eotaxin-2, selectively activates the CC chemokine receptor 3 (CCR3). The Eotaxin-3-CCR3 interaction may play an important role in allergic diseases such as atopic dermatitis and bronchial asthma. The full-length cDNA for CCL26 encodes a protein of 94 amino acids with a putative signal peptide of either 23 or 26 amino acid residues. Both the 71 and 68 amino acid residue variants of recombinant CCL26 demonstrate equal potency in inducing chemotaxis of a human CCR3-transfected cell line. Unlike most other CC chemokines, CCL26 maps to human chromosome 7q11.2, within 40 kilobases of the Eotaxin-2 loci. CCL26 and Eotaxin-2 are unique in that they are the only chemokines identified to date that map to chromosome 7.
MW :8.53kD.
Recombinant Human C-C Motif Chemokine 26 is produced by our E.coli expression system and the target gene encoding Thr24-Leu94 is expressed. Chemokine Ligand 26 protein (CCL26) is a novel small cytokine belonging to the CC chemokine family which is involved in immunoregulatory and inflammatory processes. CCL26 is constitutively expressed in thymus, but only transiently expressed in phytohemagglutinin-stimulated peripheral blood mononuclear cells. It specifically binds and induces chemotaxis in T cells and elicits its effects by interacting with the chemokine receptor CCR4. CCL26, along with Eotaxin-1 and Eotaxin-2, selectively activates the CC chemokine receptor 3 (CCR3). The Eotaxin-3-CCR3 interaction may play an important role in allergic diseases such as atopic dermatitis and bronchial asthma. The full-length cDNA for CCL26 encodes a protein of 94 amino acids with a putative signal peptide of either 23 or 26 amino acid residues. Both the 71 and 68 amino acid residue variants of recombinant CCL26 demonstrate equal potency in inducing chemotaxis of a human CCR3-transfected cell line. Unlike most other CC chemokines, CCL26 maps to human chromosome 7q11.2, within 40 kilobases of the Eotaxin-2 loci. CCL26 and Eotaxin-2 are unique in that they are the only chemokines identified to date that map to chromosome 7.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Ubiquitously expressed at low levels in various tissues including heart and ovary. |
| BioGrid: | 115626. 19 interactions. |
|
There are currently no product reviews
|





















.png)











