Recombinant Human C-C Motif Chemokine 4/CCL4 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSETWVQEYVYDLELNVDHHHHHH |
Source: Human Cells.
MW :8.87kD.
Recombinant Human C-C Motif Chemokine 4 is produced by our Mammalian expression system and the target gene encoding Ala24-Asn92 is expressed with a 6His tag at the C-terminus. C-C Motif Chemokine 4 (CCL4) is a secreted protein which belongs to the intercrine beta (chemokine CC) family. CCL4 is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form CCL4 (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. CCL4 (3-69) is also a ligand for CCR1 and CCR2 isoform B.
MW :8.87kD.
Recombinant Human C-C Motif Chemokine 4 is produced by our Mammalian expression system and the target gene encoding Ala24-Asn92 is expressed with a 6His tag at the C-terminus. C-C Motif Chemokine 4 (CCL4) is a secreted protein which belongs to the intercrine beta (chemokine CC) family. CCL4 is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form CCL4 (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. CCL4 (3-69) is also a ligand for CCR1 and CCR2 isoform B.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. |
| BioGrid: | 112254. 6 interactions. |
|
There are currently no product reviews
|












.png)









