Recombinant Human C-X-C Motif Chemokine 1/CXCL1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSNVDHHHHHH |
Source: Human Cells.
MW :8.9kD.
Recombinant Human C-X-C Motif Chemokine 1 is produced by our Mammalian expression system and the target gene encoding Ala35-Asn107 is expressed with a 6His tag at the C-terminus. Chemokine (C-X-C motif) Ligand 1 Protein (CXCL1) is a growth factor for melanoma cells and a chemotaxin for neutrophils and a member of the CXC chemokine family that is a potent neutrophil attractant and activator and is also active toward basophils. CXCL1 is expressed by macrophages, neutrophils and epithelial cells; it has neutrophil chemoattractant activity. CXCL1 plays a critical nonredundant role in the development of experimental Lyme arthritis and carditis via CXCR2-mediated recruitment of neutrophils into the site of infection and may also have important pro-nociceptive effects via its direct actions on sensory neurons, and may induce long-term changes that involve protein synthesis.
MW :8.9kD.
Recombinant Human C-X-C Motif Chemokine 1 is produced by our Mammalian expression system and the target gene encoding Ala35-Asn107 is expressed with a 6His tag at the C-terminus. Chemokine (C-X-C motif) Ligand 1 Protein (CXCL1) is a growth factor for melanoma cells and a chemotaxin for neutrophils and a member of the CXC chemokine family that is a potent neutrophil attractant and activator and is also active toward basophils. CXCL1 is expressed by macrophages, neutrophils and epithelial cells; it has neutrophil chemoattractant activity. CXCL1 plays a critical nonredundant role in the development of experimental Lyme arthritis and carditis via CXCR2-mediated recruitment of neutrophils into the site of infection and may also have important pro-nociceptive effects via its direct actions on sensory neurons, and may induce long-term changes that involve protein synthesis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N-terminal processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. |
| BioGrid: | 109176. 10 interactions. |
|
There are currently no product reviews
|















.png)









