Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1/TIMP1
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR |
Source: Human Cells.
MW :20.2kD.
Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1 is produced by our Mammalian expression system and the target gene encoding Cys25-Arg205 is expressed. Tissue Inhibitor of Metalloproteinases 1 (TIMP-1) complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13, and MMP-16. TIMP-1 does not act on MMP-14.
MW :20.2kD.
Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1 is produced by our Mammalian expression system and the target gene encoding Cys25-Arg205 is expressed. Tissue Inhibitor of Metalloproteinases 1 (TIMP-1) complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13, and MMP-16. TIMP-1 does not act on MMP-14.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Found in fetal and adult tissues. Highest levels are found in bone. Also found in lung, ovary and uterus. |
|
There are currently no product reviews
|















.png)








